6U7E: HCoV-229E RBD Class III

HCoV-229E RBD Class III in complex with human APN. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 Nov 2019.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Human coronavirus 229E
Chains: 4
Atoms: 16,543
Mol. weight: 243.18 kDa
Ligands: NAG, ZN
Released: 13 Nov 2019

Explore 6U7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6U7E contains 105 α-helices and 101 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 50 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	70-72	3
α-helix	76-77	2
β-strand	80-91	12	1
β-strand	102-113	12	1
β-strand	119-123	5	2
β-strand	128-129	2	1
β-strand	132	1	3
β-strand	135	1	3
β-strand	137-141	5	1
α-helix	147-149	3
β-strand	150-156	7	2
β-strand	161-166	6	2
α-helix	169-171	3
β-strand	175-185	11	1
β-strand	192-200	9	4
β-strand	203-211	9	4
α-helix	217-219	3
β-strand	223	1	2
β-strand	231	1	5
β-strand	232-240	9	1
β-strand	244-247	4	4
β-strand	251	1	6
α-helix	255	1
β-strand	256-257	2	1
α-helix	258	1
β-strand	264-268	5	1
β-strand	269	1	6
α-helix	270-272	3
β-strand	275	1	5
α-helix	277-279	3
β-strand	282-285	4	4
β-strand	288-293	6	7
β-strand	299-304	6	7
α-helix	306-311	6
α-helix	315-331	17
β-strand	340-346	7	7
β-strand	353-354	2	7
β-strand	359-363	5	7
α-helix	364-366	3
α-helix	376-392	17
β-strand	395	1	8
β-strand	399-401	3	8
α-helix	404-406	3
α-helix	408-425	18
α-helix	427-429	3
α-helix	431-434	4
α-helix	435	1
α-helix	436-440	5
α-helix	441-447	7
α-helix	459-461	3
α-helix	465-470	6
α-helix	474	1
α-helix	475-479	5
α-helix	480-491	12
α-helix	493-506	14
β-strand	510-512	3	8
α-helix	514-527	14
α-helix	536-544	9
β-strand	550-555	6	9
β-strand	560-565	6	9
β-strand	586-588	3	10
β-strand	590-592	3	11
β-strand	596	1	11
β-strand	600-602	3	10
β-strand	606-608	3	9
α-helix	610-612	3
β-strand	620-622	3	11
α-helix	624-626	3
β-strand	631-633	3	9
α-helix	636-649	14
α-helix	650-652	3
α-helix	655-670	16
α-helix	676-681	6
α-helix	685-688	4
α-helix	693-709	17
α-helix	715-736	22
α-helix	747-762	16
α-helix	766-781	16
α-helix	790-803	14
α-helix	806-817	12
α-helix	822-832	11
α-helix	838-847	10
α-helix	856-868	13
α-helix	873-882	10
α-helix	884-890	7
α-helix	898-905	8
α-helix	912-924	13
α-helix	931-933	3
α-helix	934-965	32

Chain B: 53 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	70-72	3
α-helix	76-77	2
β-strand	80-91	12	12
β-strand	102-113	12	12
β-strand	119-123	5	13
β-strand	127-129	3	12
β-strand	132	1	14
β-strand	135	1	14
β-strand	137-141	5	12
α-helix	147-149	3
β-strand	150-156	7	13
β-strand	161-166	6	13
α-helix	169-171	3
β-strand	175-185	11	12
β-strand	192-200	9	15
β-strand	203-211	9	15
α-helix	217-219	3
β-strand	223	1	13
β-strand	231	1	16
β-strand	232-240	9	12
β-strand	244-247	4	15
β-strand	251	1	17
β-strand	256-257	2	12
β-strand	264-268	5	12
β-strand	269	1	17
α-helix	270-273	4
β-strand	275	1	16
α-helix	277-279	3
β-strand	282-285	4	15
β-strand	288-293	6	18
β-strand	299-304	6	18
α-helix	306-311	6
α-helix	315-331	17
β-strand	340-346	7	18
β-strand	353-354	2	18
β-strand	359-363	5	18
α-helix	364-367	4
α-helix	376-392	17
α-helix	393-398	6
β-strand	399-401	3	19
α-helix	404-406	3
α-helix	407-425	19
α-helix	427-429	3
α-helix	431-434	4
α-helix	435	1
α-helix	436-440	5
α-helix	441-447	7
α-helix	459-461	3
α-helix	465-470	6
α-helix	474	1
α-helix	475-479	5
α-helix	480-491	12
α-helix	493-506	14
β-strand	510-512	3	19
α-helix	514-528	15
α-helix	536-544	9
β-strand	550-555	6	20
β-strand	560-565	6	20
β-strand	586-588	3	21
β-strand	590-592	3	22
β-strand	595-596	2	22
α-helix	597-599	3
β-strand	600-602	3	21
β-strand	606-608	3	20
α-helix	610-612	3
β-strand	620-622	3	22
α-helix	624-626	3
β-strand	631-634	4	20
α-helix	636-648	13
α-helix	650-652	3
α-helix	655-670	16
α-helix	676-681	6
α-helix	684-688	5
α-helix	692-709	18
α-helix	715-736	22
α-helix	747-762	16
α-helix	766-781	16
α-helix	790-803	14
α-helix	806-817	12
α-helix	822-831	10
α-helix	832-834	3
α-helix	838-848	11
α-helix	856-858	3
α-helix	859-868	10
α-helix	870-882	13
α-helix	884-889	6
α-helix	898-905	8
α-helix	906-908	3
α-helix	912-924	13
α-helix	931-933	3
α-helix	934-965	32

Chain C: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	303-305	3	23
β-strand	308-309	2	24
β-strand	317	1	7
α-helix	321-322	2
β-strand	324-325	2	24
β-strand	328-329	2	23
β-strand	339-340	2	25
β-strand	349-351	3	23
β-strand	354-355	2	25
β-strand	358-362	5	25
β-strand	384-386	3	25
β-strand	394-402	9	25
β-strand	407-415	9	25

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	300-306	7	26
β-strand	308-309	2	27
β-strand	317	1	18
α-helix	321-322	2
β-strand	324-325	2	27
β-strand	328-329	2	26
β-strand	339-340	2	28
β-strand	346-352	7	26
β-strand	354-355	2	28
β-strand	358-362	5	28
β-strand	384-386	3	28
β-strand	394-402	9	28
β-strand	407-416	10	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aminopeptidase N	A, B	protein	906	Homo sapiens	P15144 (AlphaFold model)
Spike glycoprotein	C, D	protein	145	Human coronavirus 229E	Q1HVL8

Sequence of entity 1 (A, B), FASTA

>6U7E_1 Aminopeptidase N (chains A, B)
GGRPDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVII
IHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSE
FEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPK
DLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIR
IWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVT
YRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLG
ADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGA
SVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMN
RWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDYW
LIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQI
INDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNY
LKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWME
NPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWIL
NRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNL
IQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQW
FTENSK

Sequence of entity 2 (C, D), FASTA

>6U7E_2 Spike glycoprotein (chains C, D)
GGRPLPVYHKHMFIVLYVDFKLQSGVGRCFNCRPAVVNITLANFNETKGPLCVDTSHFTT
KFVGANFGRWSASINTGNCPFSFGKVNNFVKFGSVCFSLKDIPGGCAMPIVANLAYLNSY
TIGTLYVSWSDGDGITGVPQPVEGV

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12
ZN	Zinc ion	Zn	2

Primary citation

The human coronavirus HCoV-229E S-protein structure and receptor binding. Li, Z., Tomlinson, A.C.A., Wong, A.H.M. et al. Elife (2019) 8. DOI 10.7554/eLife.51230 · PubMed

Other PDB entries of the same protein (UniProt P15144 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AEW 1.2 Å, 14-3-3 sigma bound to bis-phosphorylated aminopeptidase N (APN, CD13) via canonical and…
6XWD 1.6 Å, 14-3-3 sigma bound to canonical mono-phosphorylated aminopeptidase N (APN, CD13) binding…
4FYT 1.85 Å, Human aminopeptidase N (CD13) in complex with amastatin
4FYQ 1.9 Å, Human aminopeptidase N (CD13)
4FYR 1.91 Å, Human aminopeptidase N (CD13) in complex with bestatin
4FYS 2.01 Å, Human aminopeptidase N (CD13) in complex with angiotensin IV
6U7G 2.35 Å, HCoV-229E RBD Class V in complex with human APN
5LHD 2.6 Å, Structure of glycosylated human aminopeptidase N
6U7F 2.75 Å, HCoV-229E RBD Class IV in complex with human APN
9CAM 2.96 Å, Aminopeptidase N close state
7VPQ 3.1 Å, Structures of a deltacoronavirus spike protein bound to porcine and human receptors…
9CAO 3.14 Å, Aminopeptidase N open state

Browse structure collections

About this viewer

MolViewer shows 6U7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.