14-3-3 sigma bound to bis-phosphorylated aminopeptidase N (APN, CD13) via canonical and non-canonical binding motifs. Determined by X-ray diffraction at 1.2 Å resolution. Released 4 Nov 2020.
Explore 7AEW in 3D Show helices and sheets RCSB PDB PDBe
7AEW contains 15 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-69 | 32 | |
| α-helix | 74-76 | 3 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-204 | 18 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 61-64 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 41-45 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | AAA | protein | 236 | Homo sapiens | P31947 (AlphaFold model) |
| Aminopeptidase N | BBB, CCC | protein | 38 | Homo sapiens | P15144 (AlphaFold model) |
>7AEW_1 14-3-3 protein sigma (chains AAA) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
>7AEW_2 Aminopeptidase N (chains BBB, CCC) EKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNR
MMP activation-associated aminopeptidase N reveals a bivalent 14-3-3 binding motif. Kiehstaller, S., Ottmann, C., Hennig, S. J Biol Chem (2020) 295:18266-18275. DOI 10.1074/jbc.RA120.014708 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7AEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.