Wild-type MthK pore in 11 mM K+. Determined by X-ray diffraction at 1.8 Å resolution. Released 4 Nov 2020.
Explore 6U9Y in 3D Show helices and sheets RCSB PDB PDBe
6U9Y contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-42 | 23 | |
| α-helix | 46-57 | 12 | |
| α-helix | 70-98 | 29 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calcium-gated potassium channel MthK | A | protein | 82 | Methanothermobacter thermautotrophicus | O27564 (AlphaFold model) |
>6U9Y_1 Calcium-gated potassium channel MthK (chains A) VPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTV TLIVLGIGTFAVAVERLLEFLI
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEZ | Hexane-1,6-diol | C6 H14 O2 | 1 |
Water and common crystallization additives (K) are not listed.
Selectivity filter ion binding affinity determines inactivation in a potassium channel. Boiteux, C., Posson, D.J., Allen, T.W. et al. Proc Natl Acad Sci U S A (2020) 117:29968-29978. DOI 10.1073/pnas.2009624117 · PubMed
Other PDB entries of the same protein (UniProt O27564 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.