Fab397 in complex with NPNA peptide. Determined by X-ray diffraction at 1.75 Å resolution. Released 8 Jan 2020.
Explore 6UC5 in 3D Show helices and sheets RCSB PDB PDBe
6UC5 contains 20 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 18-24 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 46-51 | 6 | 2 |
| α-helix | 52B-53 | 3 | |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-94 | 7 | 2 |
| α-helix | 96-100A | 6 | |
| β-strand | 102 | 1 | 3 |
| β-strand | 107-109 | 3 | 2 |
| β-strand | 116 | 1 | 4 |
| α-helix | 117-118 | 2 | |
| β-strand | 119-123 | 5 | 5 |
| α-helix | 127-129 | 3 | |
| β-strand | 130-131 | 2 | 5 |
| β-strand | 134-144 | 11 | 5 |
| β-strand | 145 | 1 | 4 |
| β-strand | 150-153 | 4 | 6 |
| α-helix | 154-156 | 3 | |
| β-strand | 158 | 1 | 6 |
| β-strand | 162-164 | 3 | 5 |
| α-helix | 165-167 | 3 | |
| β-strand | 168-169 | 2 | 5 |
| β-strand | 175-184 | 10 | 5 |
| α-helix | 185-187 | 3 | |
| β-strand | 194-199 | 6 | 6 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-209 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 7 |
| β-strand | 10-13 | 4 | 3 |
| β-strand | 19-25 | 7 | 7 |
| β-strand | 27C | 1 | 8 |
| β-strand | 31 | 1 | 8 |
| β-strand | 33-38 | 6 | 3 |
| β-strand | 45-49 | 5 | 3 |
| β-strand | 53-54 | 2 | 3 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 7 |
| β-strand | 70-75 | 6 | 7 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 3 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 3 |
| β-strand | 102-106 | 5 | 3 |
| β-strand | 111 | 1 | 9 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 10 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 10 |
| β-strand | 140 | 1 | 9 |
| β-strand | 145-150 | 6 | 11 |
| β-strand | 153-154 | 2 | 11 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 10 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 10 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 11 |
| β-strand | 205-210 | 6 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab397 heavy chain | H | protein | 220 | Homo sapiens | A8K008 (AlphaFold model) |
| Fab397 light chain | L | protein | 218 | Homo sapiens | Q8TCD0 (AlphaFold model) |
| NPNA peptide | P | protein | 11 | Plasmodium falciparum 3D7 | P02893 (AlphaFold model) |
>6UC5_1 Fab397 heavy chain (chains H) QLVKSGGXXXVKPGGSLRLSCAVSGFTFTDAWMSWVRQAPGKGPEWVGRIKSNPDGGTTD YAAPVRGRFTISRDDSKNTLYLQMNNLKTEDTAVYYCITDRDFYRSGGSWGQGTLVTVVS RRLPPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
>6UC5_2 Fab397 light chain (chains L) DIVMTQSPLSLPVTPGEPASISCRSRQSLLYSNGDNYLDWYLQKPGQSPQLLIYLGSNRA PGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQTLQTPHTFGQGTKLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
>6UC5_3 NPNA peptide (chains P) NPNANPNANPN
Diverse Antibody Responses to Conserved Structural Motifs in Plasmodium falciparum Circumsporozoite Protein. Pholcharee, T., Oyen, D., Torres, J.L. et al. J Mol Biol (2020) 432:1048-1063. DOI 10.1016/j.jmb.2019.12.029 · PubMed
Other PDB entries of the same protein (UniProt A8K008 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6UC5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.