6UGT: PF06438179 Fab Heavy Chain

Crystal structure of the Fab fragment of PF06438179/GP1111 an infliximab biosimilar in a I-centered orthorhombic crystal form, Lot A. Determined by X-ray diffraction at 2.15 Å resolution. Released 13 Nov 2019.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,261
Mol. weight: 96.07 kDa
Released: 13 Nov 2019

Explore 6UGT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UGT contains 38 α-helices and 88 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	11
β-strand	10-12	3	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	33-40	8	12
β-strand	44-51	8	12
α-helix	54-56	3
β-strand	60-62	3	12
β-strand	70-75	6	11
α-helix	76-78	3
β-strand	80-85	6	11
α-helix	90-92	3
β-strand	94-101	8	12
β-strand	107-110	4	12
β-strand	114-118	5	12
α-helix	122-123	2
β-strand	124	1	13
α-helix	125-126	2
β-strand	127-131	5	14
α-helix	135-137	3
β-strand	138-139	2	14
β-strand	142-152	11	14
β-strand	153	1	13
β-strand	158-161	4	15
α-helix	162-164	3
β-strand	166	1	15
β-strand	170-172	3	14
α-helix	173-175	3
β-strand	176-177	2	14
β-strand	183-192	10	14
α-helix	193-195	3
β-strand	202-207	6	15
α-helix	208-210	3
β-strand	212-217	6	15

Chain B: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	16
β-strand	10-13	4	17
β-strand	19-25	7	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-67	6	16
β-strand	70-75	6	16
α-helix	80-82	3
β-strand	84-90	7	17
α-helix	96	1
β-strand	97-98	2	17
β-strand	102-106	5	17
β-strand	111	1	18
α-helix	112-113	2
β-strand	114-118	5	19
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	19
β-strand	140	1	18
β-strand	144-150	7	20
β-strand	153-154	2	20
α-helix	155	1
β-strand	159-163	5	19
α-helix	164-167	4
β-strand	173-182	10	19
α-helix	183-186	4
β-strand	191-198	8	20
β-strand	205-210	6	20

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-40	8	2
β-strand	44-51	8	2
α-helix	54-56	3
β-strand	60-62	3	2
β-strand	70-75	6	1
α-helix	76-78	3
β-strand	80-85	6	1
α-helix	90-92	3
β-strand	94-101	8	2
β-strand	107-110	4	2
β-strand	114-118	5	2
α-helix	122-123	2
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
β-strand	138-139	2	4
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-161	4	5
α-helix	162-164	3
β-strand	166	1	5
β-strand	170-172	3	4
α-helix	173-175	3
β-strand	176-177	2	4
β-strand	183-192	10	4
α-helix	193-195	3
β-strand	202-207	6	5
α-helix	208-210	3
β-strand	212-217	6	5

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-106	5	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	144-150	7	10
β-strand	153-154	2	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-187	5
β-strand	191-198	8	10
β-strand	205-210	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PF06438179 Fab Heavy Chain	A, H	protein	226	Homo sapiens	A8K008 (AlphaFold model)
PF06438179 Fab Light Chain	B, L	protein	214	Homo sapiens	Q6P5S8 (AlphaFold model)

Sequence of entity 1 (A, H), FASTA

>6UGT_1 PF06438179 Fab Heavy Chain (chains A, H)
EVKLEESGGGLVQPGGSMKLSCVASGFIFSNHWMNWVRQSPEKGLEWVAEIRSKSINSAT
HYAESVKGRFTISRDDSKSAVYLQMTDLRTEDTGVYYCSRNYYGSTYDYWGQGTTLTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT

Sequence of entity 2 (B, L), FASTA

>6UGT_2 PF06438179 Fab Light Chain (chains B, L)
DILLTQSPAILSVSPGERVSFSCRASQFVGSSIHWYQQRTNGSPRLLIKYASESMSGIPS
RFSGSGSGTDFTLSINTVESEDIADYYCQQSHSWPFTFGSGTNLEVKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Crystal Structures of PF-06438179/GP1111, an Infliximab Biosimilar. Lerch, T.F., Sharpe, P., Mayclin, S.J. et al. BioDrugs (2020) 34:77-87. DOI 10.1007/s40259-019-00390-1 · PubMed

Other PDB entries of the same protein (UniProt A8K008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O5L 1.5 Å, Crystal structure of broadly neutralizing antibody F045-092
6UC5 1.75 Å, Fab397 in complex with NPNA peptide
6UGS 1.95 Å, Crystal structure of the Fab fragment of PF06438179/GP1111 an infliximab biosimilar in a…
6UGU 2.2 Å, Crystal structure of the Fab fragment of anti-TNFa antibody infliximab (Remicade) in a…
6UGV 2.4 Å, Crystal structure of the Fab fragment of anti-TNFa antibody infliximab (Remicade) in a…
6NZ7 2.95 Å, Crystal structure of broadly neutralizing Influenza A antibody 429 B01 in complex with…
6AL5 3.0 Å, Complex between CD19 (N138Q mutant) and B43 FAB

Browse structure collections

About this viewer

MolViewer shows 6UGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.