6UE7: Dimeric sIgA complex

Structure of dimeric sIgA complex. Determined by electron microscopy at 2.9 Å resolution. Released 19 Feb 2020.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 6
Atoms: 11,701
Mol. weight: 190.84 kDa
Ligands: NAG
Released: 19 Feb 2020

Explore 6UE7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UE7 contains 43 α-helices and 147 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	245-248	4	1
α-helix	250-252	3
α-helix	253-257	5
β-strand	265	1	2
β-strand	266-269	4	1
β-strand	290	1	2
β-strand	296-297	2	3
β-strand	301-302	2	3
β-strand	304	1	1
β-strand	307	1	2
α-helix	312-317	6
β-strand	321-324	4	4
β-strand	335-338	4	4
β-strand	348-352	5	5
α-helix	353-355	3
β-strand	365-374	10	5
β-strand	380-385	6	6
β-strand	388-389	2	6
α-helix	390-391	2
α-helix	392-394	3
β-strand	396-397	2	5
β-strand	401-402	2	5
β-strand	411-419	9	5
α-helix	421-426	6
β-strand	430-435	6	6
β-strand	444-448	5	6
β-strand	459-462	4	7

Chain B: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	245	1	8
β-strand	248-249	2	9
α-helix	250-252	3
α-helix	253-258	6
β-strand	264-266	3	9
β-strand	269	1	8
β-strand	271	1	10
β-strand	278-281	4	11
β-strand	290	1	9
β-strand	302	1	10
β-strand	306-308	3	9
α-helix	313-317	5
β-strand	320-326	7	11
β-strand	336-339	4	11
α-helix	346-347	2
β-strand	348-352	5	12
α-helix	353-355	3
α-helix	356-361	6
β-strand	364-374	11	12
β-strand	380-385	6	13
β-strand	388-389	2	13
α-helix	390-391	2
α-helix	392-394	3
β-strand	396-397	2	12
β-strand	401-402	2	12
α-helix	403-405	3
β-strand	407	1	14
β-strand	411-420	10	12
α-helix	421-426	6
β-strand	430-435	6	13
β-strand	444-448	5	13
β-strand	459-462	4	7

Chain C: 11 helices, 52 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	15
β-strand	9-13	5	16
β-strand	18-23	6	15
β-strand	35-40	6	16
β-strand	46-51	6	16
β-strand	55	1	14
β-strand	56	1	16
β-strand	65-69	5	15
β-strand	74-79	6	15
α-helix	84-86	3
β-strand	88-94	7	16
β-strand	102-110	9	16
β-strand	120	1	17
β-strand	123-125	3	18
β-strand	130-135	6	19
β-strand	146-151	6	17
β-strand	154-157	4	17
β-strand	159	1	20
β-strand	165	1	20
α-helix	167-169	3
β-strand	173-176	4	19
β-strand	184-189	6	19
α-helix	194-196	3
β-strand	198-203	6	17
β-strand	214-217	4	17
β-strand	218-220	3	18
α-helix	221-224	4
β-strand	226-229	4	21
β-strand	234-239	6	22
α-helix	243-245	3
β-strand	250-254	5	21
β-strand	262-266	5	21
β-strand	271	1	21
β-strand	279	1	22
α-helix	282-284	3
β-strand	290-295	6	22
β-strand	304-309	6	21
β-strand	321-328	8	21
β-strand	340-344	5	23
β-strand	348-354	7	24
α-helix	357-359	3
β-strand	364-368	5	23
β-strand	370	1	25
β-strand	376	1	25
β-strand	379-382	4	23
β-strand	387	1	23
α-helix	389-391	3
β-strand	395-398	4	24
β-strand	405-411	7	24
α-helix	415-417	3
β-strand	419-425	7	23
β-strand	433-440	8	23
β-strand	447	1	26
β-strand	452	1	27
β-strand	460-462	3	28
β-strand	465	1	26
α-helix	468-470	3
β-strand	474-479	6	27
β-strand	486-487	2	27
β-strand	511-513	3	28
α-helix	518-520	3
β-strand	522-530	9	27
β-strand	533-542	10	27

Chain D: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	37
β-strand	16-23	8	37
β-strand	33-43	11	37
β-strand	60-61	2	7
α-helix	65-68	4
β-strand	75-78	4	44
β-strand	83-86	4	44
β-strand	87	1	35
β-strand	111-116	6	45
β-strand	123-128	6	45

Chain F: 9 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	245-249	5	29
α-helix	250-252	3
α-helix	253-257	5
β-strand	265-269	5	29
β-strand	279-280	2	30
β-strand	290	1	31
α-helix	291-293	3
β-strand	296-297	2	32
β-strand	301-302	2	32
β-strand	303-306	4	29
β-strand	307	1	31
α-helix	312-317	6
β-strand	321	1	33
β-strand	324-325	2	30
β-strand	334-335	2	30
β-strand	338	1	33
β-strand	348-352	5	34
α-helix	353-354	2
β-strand	364-374	11	34
β-strand	380-385	6	35
β-strand	388-389	2	35
α-helix	390-391	2
α-helix	392-394	3
β-strand	396-397	2	34
β-strand	401-402	2	34
α-helix	403-405	3
β-strand	406	1	36
β-strand	408	1	36
β-strand	411-420	10	34
α-helix	421-424	4
β-strand	430-435	6	35
β-strand	443-448	6	35
β-strand	457-465	9	37

Chain G: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	245-247	3	38
α-helix	253-256	4
β-strand	267-269	3	38
β-strand	281	1	39
β-strand	291	1	40
β-strand	295-296	2	38
β-strand	302-304	3	38
β-strand	306	1	40
β-strand	323	1	39
β-strand	324	1	41
β-strand	335	1	41
β-strand	348-352	5	42
α-helix	353-355	3
α-helix	356-359	4
β-strand	364-374	11	42
β-strand	380-385	6	43
β-strand	388-389	2	43
α-helix	390-391	2
β-strand	396-397	2	42
β-strand	401-403	3	42
β-strand	410-420	11	42
α-helix	421-426	6
β-strand	430-435	6	43
β-strand	443-448	6	43
β-strand	458-463	6	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin heavy constant alpha 1	A, B, F, G	protein	245	Homo sapiens	P01876 (AlphaFold model)
Polymeric immunoglobulin receptor	C	protein	591	Homo sapiens	P01833 (AlphaFold model)
Immunoglobulin J chain	D	protein	137	Homo sapiens	P01591 (AlphaFold model)

Sequence of entity 1 (A, B, F, G), FASTA

>6UE7_1 Immunoglobulin heavy constant alpha 1 (chains A, B, F, G)
DYKDDDDKLVPRGSCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGK
SAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRP
EVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQG
TTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEV
DGTCY

Sequence of entity 2 (C), FASTA

>6UE7_2 Polymeric immunoglobulin receptor (chains C)
KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKY
AGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTK
VYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGT
GQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCA
LGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKE
DAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKES
KSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGF
YWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKW
NNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAV
YVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPRHHHHHH

Sequence of entity 3 (D), FASTA

>6UE7_3 Immunoglobulin J chain (chains D)
QEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRENISDPTSPLRTR
FVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGG
ETKMVETALTPDACYPD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	7

Primary citation

Structure of the secretory immunoglobulin A core. Kumar, N., Arthur, C.P., Ciferri, C. et al. Science (2020) 367:1008-1014. DOI 10.1126/science.aaz5807 · PubMed

Other PDB entries of the same protein (UniProt P01876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R2E 2.54 Å, Structure of ARGX-121 Fab fragment in complex with the Fc fragment of IgA1
9OFR 2.65 Å, Crystal structure of the human IGA1 fc fragment-fc-alpha receptor (CD89) complex
1OW0 3.1 Å, Crystal structure of human FcaRI bound to IgA1-Fc
8SKV 3.1 Å, Structure of human SIgA1 in complex with Streptococcus pyogenes protein M4 (Arp4)
6LX3 3.15 Å, Cryo-EM structure of human secretory immunoglobulin A
2QEJ 3.2 Å, Crystal structure of a Staphylococcus aureus protein (SSL7) in complex with Fc of human…
8SKU 3.2 Å, Structure of human SIgA1 in complex with human CD89 (FcaR1)
6LXW 3.27 Å, Cryo-EM structure of human secretory immunoglobulin A in complex with the N-terminal…
9MBZ 3.3 Å, Cryo-EM structure of human FcRL4 bound to IgA-Fc/J
7UVL 3.56 Å, IgA1 Protease with IgA1 substrate
6XJA 4.0 Å, Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate
1IGA Model of human IGA1 determined by solution scattering curve-fitting and homology modelling

Browse more

6UE7 is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 6UE7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.