6UZB: Anthrax toxin protective antigen channels

Anthrax toxin protective antigen channels bound to edema factor. Determined by electron microscopy at 3.2 Å resolution. Released 4 Mar 2020.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Bacillus anthracis
Chains: 8
Atoms: 36,951
Mol. weight: 668.9 kDa
Ligands: CA
Released: 4 Mar 2020

Explore 6UZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UZB contains 158 α-helices and 314 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	1
β-strand	201-205	5	1
α-helix	210-213	4
β-strand	219	1	1
α-helix	235-240	6
α-helix	249-252	4
β-strand	256	1	2
β-strand	262-273	12	3
β-strand	278-296	19	4
β-strand	299-300	2	5
β-strand	303-309	7	4
β-strand	318-319	2	4
β-strand	322	1	4
β-strand	327-328	2	5
β-strand	330-351	22	4
β-strand	358-368	11	3
β-strand	374-385	12	6
β-strand	389-395	7	6
α-helix	398-400	3
β-strand	402-405	4	6
β-strand	410-411	2	3
α-helix	417-418	2
β-strand	419-421	3	3
β-strand	432-434	3	3
α-helix	436-445	10
β-strand	448-462	15	6
β-strand	469-476	8	6
α-helix	481-487	7
β-strand	488-493	6	2
β-strand	501-506	6	2
β-strand	508	1	7
α-helix	519-520	2
β-strand	522	1	8
α-helix	523-531	9
β-strand	534	1	9
β-strand	541-542	2	9
β-strand	545-546	2	9
α-helix	547-549	3
β-strand	550-554	5	2
α-helix	556-568	13
α-helix	574-576	3
β-strand	582	1	8
β-strand	584	1	7
β-strand	588-593	6	2
β-strand	596-598	3	10
β-strand	604-607	4	10
α-helix	609-613	5
β-strand	628-629	2	11
β-strand	639-647	9	12
β-strand	654-655	2	12
β-strand	666-667	2	11
β-strand	674-676	3	11
α-helix	680-682	3
β-strand	695-702	8	12
β-strand	727-730	4	12

Chain B: 21 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	13
β-strand	201-205	5	13
α-helix	210-213	4
α-helix	216-218	3
β-strand	219	1	13
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	14
β-strand	262-269	8	15
β-strand	272-273	2	16
β-strand	275-311	37	4
β-strand	316-353	38	4
β-strand	358-360	3	16
β-strand	362-368	7	15
β-strand	374-385	12	17
β-strand	389-395	7	17
α-helix	398-400	3
β-strand	402-405	4	17
β-strand	409-411	3	15
α-helix	417-418	2
β-strand	419-421	3	15
β-strand	432-434	3	16
α-helix	436-445	10
β-strand	448-462	15	17
β-strand	469-476	8	17
α-helix	481-484	4
β-strand	488-493	6	14
β-strand	501-506	6	14
β-strand	508	1	18
α-helix	519-520	2
β-strand	522	1	19
α-helix	523-530	8
β-strand	534	1	20
β-strand	541-542	2	20
β-strand	545-546	2	20
α-helix	547-549	3
β-strand	550-554	5	14
α-helix	556-569	14
α-helix	574-576	3
α-helix	578-580	3
β-strand	582	1	19
β-strand	584	1	18
β-strand	588-593	6	14
β-strand	597-598	2	21
β-strand	604-606	3	21
α-helix	609-613	5
α-helix	614-616	3
β-strand	628-629	2	22
α-helix	633-636	4
β-strand	639-643	5	23
β-strand	645-646	2	24
β-strand	647	1	25
β-strand	654-655	2	24
α-helix	660-662	3
β-strand	666-668	3	22
β-strand	674-676	3	22
β-strand	695	1	25
β-strand	696-702	7	23
α-helix	703-705	3
β-strand	724-729	6	23
α-helix	731-733	3

Chain C: 17 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	26
β-strand	201-205	5	26
β-strand	219	1	26
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	27
β-strand	262-269	8	28
β-strand	272-273	2	29
β-strand	276-304	29	4
β-strand	307	1	30
β-strand	310-311	2	4
β-strand	316-317	2	4
β-strand	320	1	30
β-strand	323-324	2	4
β-strand	327-353	27	4
β-strand	358-360	3	29
β-strand	362-368	7	28
β-strand	375-385	11	31
β-strand	389-395	7	31
α-helix	398-400	3
β-strand	402-404	3	31
β-strand	409-411	3	28
α-helix	417-418	2
β-strand	419-421	3	28
β-strand	432-434	3	29
α-helix	436-445	10
β-strand	448-462	15	31
β-strand	469-476	8	31
α-helix	477-479	3
α-helix	481-487	7
β-strand	488-493	6	27
β-strand	501-506	6	27
β-strand	508	1	32
α-helix	514-516	3
α-helix	519-520	2
β-strand	522	1	33
α-helix	523-530	8
β-strand	534	1	34
β-strand	541-542	2	34
β-strand	545-546	2	34
α-helix	547-549	3
β-strand	550-552	3	27
α-helix	556-569	14
α-helix	581	1
β-strand	582	1	33
α-helix	583	1
β-strand	584	1	32
β-strand	588-593	6	27
β-strand	596-598	3	35
β-strand	604-607	4	35
α-helix	609-613	5
β-strand	619-622	4	36
β-strand	626-629	4	36
β-strand	639-648	10	37
β-strand	652-655	4	37
β-strand	666-668	3	36
β-strand	674-677	4	36
β-strand	695-702	8	37
α-helix	718-720	3
β-strand	728-729	2	37

Chain D: 17 helices, 39 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	38
β-strand	201-205	5	38
β-strand	219	1	38
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	39
β-strand	262-273	12	40
β-strand	276-301	26	4
β-strand	303	1	41
β-strand	306-310	5	4
β-strand	317-321	5	4
β-strand	324	1	41
β-strand	327	1	4
β-strand	329-332	4	4
β-strand	334-353	20	4
β-strand	358-368	11	40
β-strand	374-385	12	42
β-strand	389-395	7	42
α-helix	398-400	3
β-strand	402-405	4	42
β-strand	409-411	3	40
α-helix	417-418	2
β-strand	419-421	3	40
β-strand	432-434	3	40
α-helix	436-445	10
β-strand	448-462	15	42
β-strand	469-476	8	42
α-helix	481-485	5
β-strand	488-493	6	39
β-strand	501-506	6	39
α-helix	514-517	4
α-helix	519-520	2
β-strand	522	1	43
α-helix	523-530	8
β-strand	534	1	44
β-strand	541	1	44
α-helix	547-549	3
β-strand	550-552	3	39
α-helix	556-568	13
α-helix	574-576	3
β-strand	582	1	43
β-strand	588-593	6	39
β-strand	596-598	3	45
β-strand	604-607	4	45
α-helix	609-613	5
α-helix	615-617	3
β-strand	618-621	4	46
β-strand	627-630	4	46
α-helix	635-637	3
β-strand	643-646	4	47
β-strand	655	1	47
β-strand	666-668	3	46
β-strand	674-676	3	46
α-helix	686-688	3
β-strand	696-699	4	47

Chain E: 20 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	48
β-strand	201-205	5	48
α-helix	208-214	7
α-helix	216-218	3
β-strand	219	1	48
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	49
β-strand	262-273	12	50
β-strand	276-286	11	4
β-strand	289-295	7	4
β-strand	299	1	4
β-strand	301-311	11	4
β-strand	316-327	12	4
β-strand	330-338	9	4
β-strand	340-353	14	4
β-strand	358-368	11	50
β-strand	374-385	12	51
β-strand	389-395	7	51
α-helix	398-400	3
β-strand	402-405	4	51
β-strand	409-411	3	50
α-helix	417-418	2
β-strand	419-421	3	50
β-strand	432-434	3	50
α-helix	436-445	10
β-strand	448-458	11	51
β-strand	459-462	4	52
β-strand	469-472	4	52
α-helix	481-485	5
β-strand	488-493	6	49
β-strand	501-506	6	49
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	53
α-helix	523-531	9
β-strand	534	1	54
β-strand	541	1	54
α-helix	547-549	3
β-strand	550-554	5	49
α-helix	556-569	14
α-helix	574-576	3
α-helix	578-580	3
α-helix	581	1
β-strand	582	1	53
α-helix	583	1
β-strand	587-593	7	49
β-strand	597-598	2	55
β-strand	604-606	3	55
α-helix	609-614	6
β-strand	628-629	2	56
β-strand	639	1	57
β-strand	643-645	3	58
β-strand	666	1	59
β-strand	669	1	60
β-strand	673	1	60
β-strand	674-675	2	56
β-strand	676	1	59
α-helix	686-688	3
β-strand	697-699	3	58
β-strand	700	1	61
β-strand	702	1	57
β-strand	724	1	61

Chain F: 16 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	62
β-strand	201-205	5	62
α-helix	208-214	7
α-helix	216-218	3
β-strand	219	1	62
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	63
β-strand	262-269	8	64
β-strand	272-273	2	65
β-strand	276-289	14	4
β-strand	291-311	21	4
β-strand	316-351	36	4
β-strand	358-360	3	65
β-strand	362-368	7	64
β-strand	374-385	12	66
β-strand	389-395	7	66
β-strand	402-405	4	66
β-strand	410-411	2	64
α-helix	417-418	2
β-strand	419-421	3	64
β-strand	432-434	3	65
α-helix	436-445	10
β-strand	448-462	15	66
β-strand	469-476	8	66
α-helix	481-484	4
β-strand	488-493	6	63
β-strand	501-506	6	63
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	67
α-helix	523-530	8
β-strand	534	1	68
β-strand	541-542	2	68
β-strand	545-546	2	68
α-helix	547-549	3
β-strand	550-554	5	63
α-helix	556-567	12
α-helix	578-580	3
β-strand	582	1	67
β-strand	588-593	6	63
β-strand	596-598	3	69
β-strand	604-607	4	69
α-helix	609-613	5
β-strand	627-629	3	70
β-strand	639-647	9	71
β-strand	654	1	71
β-strand	666-668	3	70
β-strand	674-676	3	70
β-strand	695-702	8	71
β-strand	727-730	4	71
α-helix	731-733	3

Chain G: 16 helices, 41 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	72
β-strand	201-205	5	72
β-strand	219	1	72
α-helix	235-240	6
α-helix	249-252	4
β-strand	256	1	73
β-strand	262-273	12	74
β-strand	277-305	29	4
β-strand	307-311	5	4
β-strand	316-328	13	4
β-strand	329-330	2	5
β-strand	331	1	4
β-strand	333-351	19	4
β-strand	358-368	11	74
β-strand	374-385	12	75
β-strand	389-395	7	75
α-helix	398-400	3
β-strand	402-405	4	75
β-strand	409-411	3	74
α-helix	417-418	2
β-strand	419-421	3	74
β-strand	432-434	3	74
α-helix	436-445	10
β-strand	448-462	15	75
β-strand	469-476	8	75
α-helix	477-479	3
α-helix	481-484	4
β-strand	488-493	6	73
β-strand	501-506	6	73
β-strand	508	1	76
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	77
α-helix	523-530	8
β-strand	534	1	78
β-strand	541	1	78
β-strand	546	1	78
α-helix	547-549	3
β-strand	550-554	5	73
α-helix	556-568	13
β-strand	582	1	77
β-strand	584	1	76
β-strand	588-593	6	73
β-strand	596-598	3	79
β-strand	604-607	4	79
α-helix	609-613	5
β-strand	619	1	80
β-strand	628	1	81
β-strand	629	1	80
α-helix	633-636	4
β-strand	639-647	9	82
α-helix	661-663	3
β-strand	675	1	81
β-strand	695-702	8	82
β-strand	724-727	4	82
β-strand	730	1	82

Chain H: 36 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	21-29	9
β-strand	34	1	13
α-helix	44-53	10
α-helix	58-66	9
β-strand	70-74	5	83
α-helix	82-84	3
α-helix	89-92	4
β-strand	109-112	4	83
β-strand	118-122	5	83
α-helix	132-143	12
α-helix	145-149	5
α-helix	157-168	12
α-helix	171-176	6
α-helix	179-187	9
α-helix	193-199	7
α-helix	201-216	16
α-helix	218-220	3
α-helix	222-227	6
α-helix	231-237	7
α-helix	238-242	5
α-helix	243-254	12
α-helix	266-271	6
α-helix	276-289	14
β-strand	291-295	5	84
α-helix	300-306	7
β-strand	328	1	85
β-strand	330	1	85
α-helix	335-337	3
α-helix	347-360	14
β-strand	367	1	86
α-helix	376-381	6
β-strand	387	1	87
β-strand	393-394	2	88
β-strand	397-398	2	88
β-strand	403	1	87
β-strand	410	1	89
β-strand	413	1	90
β-strand	420	1	90
β-strand	423	1	89
β-strand	444	1	86
β-strand	445	1	91
β-strand	448	1	92
β-strand	451	1	92
β-strand	454	1	91
β-strand	456	1	85
β-strand	461-466	6	84
α-helix	468-472	5
α-helix	480-483	4
α-helix	489-503	15
α-helix	518-529	12
β-strand	562-563	2	84
α-helix	564	1
β-strand	569-570	2	84
α-helix	575-581	7
α-helix	582-586	5
β-strand	594	1	84
α-helix	627-636	10
α-helix	652-671	20
α-helix	681-702	22
α-helix	710-732	23
β-strand	738	1	83
α-helix	740-746	7
α-helix	756-765	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protective antigen	A, B, C, D, E, F, G	protein	735	Bacillus anthracis	P13423 (AlphaFold model)
Calmodulin-sensitive adenylate cyclase	H	protein	767	Bacillus anthracis	P40136 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>6UZB_1 Protective antigen (chains A, B, C, D, E, F, G)
EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF
QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY
QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN
DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT
GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT
SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL
NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA
LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL
QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR
NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY
DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG
IKKILIFSKKGYEIG

Sequence of entity 2 (H), FASTA

>6UZB_2 Calmodulin-sensitive adenylate cyclase (chains H)
MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV
LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI
INIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQK
FKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEK
GGFEKISESLKKEGVEKDRIDVLKGEKALKASGLVPEHADAFKKIARELNTYILFRPVNK
LATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQQLAVEKGNLENKKSITE
HEGEIGKIPLKLDHLRIEELKENGIILKGKKEIDNGKKYYLLESNNQVYEFRISDENNEV
QYKTKEGKITVLGEKFNWRNIEVMAKNVEGVLKPLTADYDLFALAPSLTEIKKQIPQKEW
DKVVNTPNSLEKQKGVTNLLIKYGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGD
VVNHGTEQDNEEFPEKDNEIFIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYN
KIAPGNKAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKES
VKKIAGYLSDYYNSANHIFSQEKKRKISIFRGIQAYNEIENVLKSKQIAPEYKNYFQYLK
ERITNQVQLLLTHQKSNIEFKLLYKQLNFTENETDNFEVFQKIIDEK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	14

Primary citation

Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors. Hardenbrook, N.J., Liu, S., Zhou, K. et al. Nat Commun (2020) 11:840-840. DOI 10.1038/s41467-020-14658-6 · PubMed

Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TEW 1.45 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4H2A 1.62 Å, Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
3MHZ 1.7 Å, 1.7A structure of 2-fluorohistidine labeled Protective Antigen
3TEX 1.7 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4NAM 1.7 Å, 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y)
3TEZ 1.83 Å, Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone…
4EE2 1.91 Å, Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution
5FR3 1.94 Å, X-ray crystal structure of aggregation-resistant protective antigen of Bacillus…
3INO 1.95 Å, 1.95A Resolution Structure of Protective Antigen Domain 4
3Q8B 2.0 Å, Crystal structure of WT Protective Antigen (pH 9.0)
3Q8E 2.1 Å, Crystal structure of Protective Antigen W346F (pH 8.5)
1ACC 2.1 Å, Anthrax protective antigen

Browse structure collections

About this viewer

MolViewer shows 6UZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.