6UZD: Anthrax toxin protective antigen channels

Anthrax toxin protective antigen channels bound to edema factor. Determined by electron microscopy at 3.4 Å resolution. Released 4 Mar 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Bacillus anthracis
Chains: 9
Atoms: 42,822
Mol. weight: 757.85 kDa
Ligands: CA
Released: 4 Mar 2020

Explore 6UZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UZD contains 193 α-helices and 340 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 37 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	1
β-strand	201-205	5	1
β-strand	219	1	1
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	2
β-strand	262-273	12	3
β-strand	276-311	36	4
β-strand	316-351	36	4
β-strand	358-368	11	3
β-strand	374-385	12	5
β-strand	389-395	7	5
α-helix	398-400	3
β-strand	402-405	4	5
β-strand	409-411	3	3
α-helix	417-418	2
β-strand	419-421	3	3
β-strand	433-434	2	3
α-helix	436-445	10
β-strand	448-462	15	5
β-strand	469-476	8	5
α-helix	481-484	4
β-strand	488-493	6	2
β-strand	501-506	6	2
β-strand	508	1	6
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	7
α-helix	523-531	9
β-strand	534	1	8
β-strand	541	1	8
β-strand	546	1	8
α-helix	547-549	3
β-strand	550-554	5	2
α-helix	556-568	13
α-helix	574-576	3
β-strand	582	1	7
β-strand	584	1	6
β-strand	588-593	6	2
β-strand	596-598	3	9
β-strand	604-607	4	9
α-helix	611-614	4
β-strand	619	1	10
β-strand	626-629	4	10
α-helix	636-638	3
β-strand	639-647	9	11
β-strand	654-655	2	11
β-strand	666-668	3	10
β-strand	674-677	4	10
β-strand	695-702	8	11
β-strand	727-730	4	11

Chain B: 16 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	187-190	4
β-strand	192-196	5	12
β-strand	201-205	5	12
α-helix	208-212	5
α-helix	216-218	3
β-strand	219	1	12
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	13
β-strand	262-269	8	14
β-strand	277-304	28	4
β-strand	307-308	2	4
β-strand	311	1	15
β-strand	316	1	15
β-strand	321-325	5	4
β-strand	328-353	26	4
β-strand	358-360	3	16
β-strand	362-368	7	14
β-strand	374-385	12	17
β-strand	389-395	7	17
α-helix	398-400	3
β-strand	402-405	4	17
β-strand	409-411	3	14
α-helix	417-418	2
β-strand	419-421	3	14
β-strand	432-434	3	16
α-helix	436-445	10
β-strand	448-462	15	17
β-strand	469-476	8	17
α-helix	481-485	5
β-strand	488-493	6	13
β-strand	501-506	6	13
β-strand	508	1	18
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	19
α-helix	523-531	9
β-strand	534	1	20
β-strand	541	1	20
β-strand	546	1	20
β-strand	550-554	5	13
α-helix	556-567	12
α-helix	574-576	3
α-helix	578-580	3
β-strand	582	1	19
β-strand	584	1	18
β-strand	588-593	6	13
β-strand	596-598	3	21
β-strand	604-607	4	21
α-helix	614-616	3
β-strand	619-622	4	22
β-strand	626-629	4	22
β-strand	639-647	9	23
β-strand	653-655	3	23
β-strand	666-668	3	22
β-strand	674-677	4	22
β-strand	695-702	8	23
β-strand	727-730	4	23

Chain C: 17 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	24
β-strand	201-205	5	24
α-helix	208-211	4
β-strand	219	1	24
α-helix	235-240	6
α-helix	249-252	4
β-strand	256	1	25
β-strand	262-269	8	26
β-strand	276-310	35	4
β-strand	317-351	35	4
β-strand	358-359	2	27
β-strand	362-368	7	26
β-strand	374	1	28
β-strand	375-376	2	29
β-strand	377	1	30
β-strand	378-385	8	29
β-strand	389-395	7	29
α-helix	398-400	3
β-strand	402	1	30
β-strand	405	1	28
β-strand	409-411	3	26
α-helix	417-418	2
β-strand	419-421	3	26
β-strand	433-434	2	27
α-helix	436-445	10
β-strand	448-462	15	29
β-strand	469-476	8	29
α-helix	481-486	6
β-strand	488-493	6	25
β-strand	501-506	6	25
β-strand	508	1	31
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	32
α-helix	523-530	8
β-strand	534	1	33
β-strand	541-542	2	33
β-strand	545-546	2	33
α-helix	547-549	3
β-strand	550-552	3	25
α-helix	556-569	14
α-helix	574-576	3
β-strand	582	1	32
β-strand	584	1	31
β-strand	587-593	7	25
β-strand	597-598	2	34
β-strand	604-606	3	34
β-strand	619-622	4	35
β-strand	627-629	3	35
α-helix	635-638	4
β-strand	639-647	9	36
β-strand	654-655	2	36
β-strand	666-668	3	35
β-strand	674-676	3	35
α-helix	680-682	3
β-strand	695-702	8	36
β-strand	727-730	4	36
α-helix	731-734	4

Chain D: 16 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	37
β-strand	201-205	5	37
α-helix	208-211	4
β-strand	219	1	37
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	38
β-strand	262-269	8	39
β-strand	272-273	2	40
β-strand	277-288	12	4
β-strand	290-297	8	4
β-strand	299-310	12	4
β-strand	318-350	33	4
β-strand	358-359	2	40
β-strand	362-368	7	39
β-strand	374-385	12	41
β-strand	389-395	7	41
β-strand	402-405	4	41
β-strand	409-411	3	39
α-helix	417-418	2
β-strand	419-421	3	39
α-helix	436-445	10
β-strand	448-463	16	41
β-strand	468-476	9	41
α-helix	481-485	5
β-strand	488-493	6	38
β-strand	501-506	6	38
β-strand	508	1	42
α-helix	515-517	3
α-helix	519-520	2
α-helix	523-530	8
β-strand	534	1	43
β-strand	541	1	43
β-strand	546	1	43
α-helix	547-549	3
β-strand	550-554	5	38
α-helix	556-567	12
α-helix	578-580	3
β-strand	584	1	42
β-strand	588-593	6	38
β-strand	596-598	3	44
β-strand	604-607	4	44
α-helix	610-614	5
β-strand	626-627	2	45
α-helix	633-636	4
β-strand	639-647	9	46
β-strand	654-655	2	46
β-strand	667-668	2	47
β-strand	674-675	2	47
β-strand	676-677	2	45
β-strand	695-702	8	46
β-strand	727-728	2	46
α-helix	731-733	3

Chain E: 19 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	48
β-strand	201-205	5	48
α-helix	210-213	4
β-strand	219	1	48
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	49
β-strand	262-269	8	50
β-strand	272-273	2	51
β-strand	277-304	28	4
β-strand	307-311	5	4
β-strand	317-324	8	4
β-strand	326-351	26	4
β-strand	358-360	3	51
β-strand	362-368	7	50
β-strand	374-385	12	52
β-strand	389-395	7	52
α-helix	398-400	3
β-strand	402-405	4	52
β-strand	409-411	3	50
α-helix	417-418	2
β-strand	419-421	3	50
β-strand	432-434	3	51
α-helix	436-445	10
β-strand	448-462	15	52
β-strand	469-476	8	52
α-helix	477-479	3
α-helix	481-485	5
β-strand	488-493	6	49
β-strand	501-506	6	49
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	53
α-helix	523-530	8
β-strand	534	1	54
β-strand	541	1	54
β-strand	546	1	54
α-helix	547-549	3
β-strand	550-552	3	49
α-helix	558-568	11
α-helix	574-576	3
β-strand	582	1	53
β-strand	588-593	6	49
β-strand	596-598	3	55
β-strand	604-607	4	55
α-helix	614-616	3
β-strand	619-622	4	56
β-strand	627-629	3	56
α-helix	633-636	4
β-strand	639-647	9	57
α-helix	661-663	3
β-strand	666-668	3	56
β-strand	674-676	3	56
β-strand	695-702	8	57
β-strand	729-730	2	57
α-helix	731-733	3

Chain F: 17 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	58
β-strand	201-205	5	58
β-strand	219	1	58
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	59
β-strand	262-269	8	60
β-strand	272-273	2	61
β-strand	276-311	36	4
β-strand	316-353	38	4
β-strand	358-359	2	61
β-strand	362-368	7	60
β-strand	374-385	12	62
β-strand	389-394	6	62
β-strand	402-405	4	62
β-strand	410-411	2	60
α-helix	417-418	2
β-strand	419-421	3	60
β-strand	434	1	61
α-helix	436-444	9
β-strand	448-462	15	62
β-strand	469-476	8	62
α-helix	477-479	3
α-helix	481-484	4
β-strand	488-493	6	59
β-strand	501-506	6	59
β-strand	508	1	63
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	64
α-helix	523-530	8
β-strand	534	1	65
β-strand	541	1	65
β-strand	546	1	65
α-helix	547-549	3
β-strand	550-554	5	59
α-helix	556-567	12
α-helix	574-576	3
α-helix	578-580	3
β-strand	582	1	64
β-strand	584	1	63
β-strand	587-593	7	59
β-strand	597-598	2	66
β-strand	604-606	3	66
α-helix	612-615	4
β-strand	619-622	4	67
β-strand	626-629	4	67
α-helix	636-638	3
β-strand	639	1	68
β-strand	644-647	4	69
β-strand	654-655	2	69
β-strand	668-669	2	67
β-strand	673-677	5	67
β-strand	695-698	4	69
β-strand	702	1	68
α-helix	703-705	3

Chain G: 17 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	185-188	4
β-strand	192-196	5	70
β-strand	201-205	5	70
α-helix	208-211	4
β-strand	219	1	70
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	71
β-strand	262-269	8	72
β-strand	272-273	2	73
β-strand	276-311	36	4
β-strand	316-351	36	4
β-strand	358-359	2	73
β-strand	362-368	7	72
β-strand	374-385	12	74
β-strand	389-395	7	74
α-helix	398-400	3
β-strand	402-405	4	74
β-strand	409-411	3	72
α-helix	417-418	2
β-strand	419-421	3	72
β-strand	433-434	2	73
α-helix	437-445	9
β-strand	448-462	15	74
β-strand	469-476	8	74
α-helix	477-479	3
α-helix	481-487	7
β-strand	488-493	6	71
β-strand	501-506	6	71
β-strand	508	1	75
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	76
α-helix	523-530	8
β-strand	534	1	77
β-strand	541	1	77
β-strand	546	1	77
α-helix	547-549	3
β-strand	550-554	5	71
α-helix	556-568	13
α-helix	574-576	3
β-strand	582	1	76
β-strand	584	1	75
β-strand	588-593	6	71
β-strand	597-598	2	78
β-strand	604-606	3	78
α-helix	611-613	3
β-strand	628-629	2	79
α-helix	635-637	3
β-strand	639	1	80
β-strand	643-647	5	81
β-strand	654	1	81
β-strand	666-668	3	79
β-strand	674-676	3	79
β-strand	695-699	5	81
β-strand	700	1	82
β-strand	702	1	80
β-strand	724	1	82
β-strand	729	1	81

Chain H: 39 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	22-26	5
β-strand	34	1	12
α-helix	42-53	12
α-helix	58-66	9
β-strand	70-74	5	83
α-helix	82-84	3
β-strand	95	1	84
α-helix	100	1
β-strand	101	1	84
α-helix	102-103	2
α-helix	104-106	3
β-strand	109-112	4	83
β-strand	118-122	5	83
α-helix	134-143	10
α-helix	145-148	4
β-strand	150	1	85
β-strand	155	1	85
α-helix	157-166	10
α-helix	179-182	4
α-helix	194-197	4
α-helix	201-216	16
α-helix	221-227	7
α-helix	229-237	9
α-helix	238-242	5
α-helix	243-251	9
α-helix	266-271	6
α-helix	276-289	14
β-strand	291-295	5	86
α-helix	300-306	7
β-strand	312	1	87
β-strand	330	1	87
α-helix	335-337	3
α-helix	346-349	4
α-helix	351-354	4
β-strand	365	1	88
α-helix	369-371	3
α-helix	374-376	3
β-strand	394	1	89
β-strand	397	1	89
β-strand	401	1	90
β-strand	410	1	91
β-strand	412	1	90
β-strand	413	1	92
β-strand	420	1	92
β-strand	423	1	91
β-strand	445	1	93
β-strand	446	1	88
β-strand	448	1	94
β-strand	451	1	94
β-strand	454	1	93
β-strand	456	1	87
α-helix	457-458	2
β-strand	459	1	95
β-strand	464-466	3	86
α-helix	469-474	6
α-helix	480-483	4
α-helix	489-492	4
α-helix	498-501	4
α-helix	521-527	7
β-strand	542	1	95
β-strand	561-563	3	86
β-strand	569-571	3	86
α-helix	575-581	7
α-helix	582-586	5
α-helix	627-638	12
α-helix	652-668	17
α-helix	681-703	23
α-helix	713-733	21
α-helix	740-746	7
α-helix	758-764	7

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protective antigen	A, B, C, D, E, F, G	protein	735	Bacillus anthracis	P13423 (AlphaFold model)
Calmodulin-sensitive adenylate cyclase	H, I	protein	767	Bacillus anthracis	P40136 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>6UZD_1 Protective antigen (chains A, B, C, D, E, F, G)
EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF
QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY
QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN
DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT
GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT
SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL
NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA
LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL
QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR
NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY
DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG
IKKILIFSKKGYEIG

Sequence of entity 2 (H, I), FASTA

>6UZD_2 Calmodulin-sensitive adenylate cyclase (chains H, I)
MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV
LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI
INIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQK
FKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEK
GGFEKISESLKKEGVEKDRIDVLKGEKALKASGLVPEHADAFKKIARELNTYILFRPVNK
LATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQQLAVEKGNLENKKSITE
HEGEIGKIPLKLDHLRIEELKENGIILKGKKEIDNGKKYYLLESNNQVYEFRISDENNEV
QYKTKEGKITVLGEKFNWRNIEVMAKNVEGVLKPLTADYDLFALAPSLTEIKKQIPQKEW
DKVVNTPNSLEKQKGVTNLLIKYGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGD
VVNHGTEQDNEEFPEKDNEIFIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYN
KIAPGNKAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKES
VKKIAGYLSDYYNSANHIFSQEKKRKISIFRGIQAYNEIENVLKSKQIAPEYKNYFQYLK
ERITNQVQLLLTHQKSNIEFKLLYKQLNFTENETDNFEVFQKIIDEK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	14

Primary citation

Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors. Hardenbrook, N.J., Liu, S., Zhou, K. et al. Nat Commun (2020) 11:840-840. DOI 10.1038/s41467-020-14658-6 · PubMed

Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TEW 1.45 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4H2A 1.62 Å, Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
3MHZ 1.7 Å, 1.7A structure of 2-fluorohistidine labeled Protective Antigen
3TEX 1.7 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4NAM 1.7 Å, 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y)
3TEZ 1.83 Å, Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone…
4EE2 1.91 Å, Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution
5FR3 1.94 Å, X-ray crystal structure of aggregation-resistant protective antigen of Bacillus…
3INO 1.95 Å, 1.95A Resolution Structure of Protective Antigen Domain 4
3Q8B 2.0 Å, Crystal structure of WT Protective Antigen (pH 9.0)
3Q8E 2.1 Å, Crystal structure of Protective Antigen W346F (pH 8.5)
1ACC 2.1 Å, Anthrax protective antigen

Browse structure collections

About this viewer

MolViewer shows 6UZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.