6UZE: Anthrax toxin protective antigen channels

Anthrax toxin protective antigen channels bound to edema factor. Determined by electron microscopy at 3.4 Å resolution. Released 4 Mar 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Bacillus anthracis
Chains: 9
Atoms: 42,822
Mol. weight: 757.85 kDa
Ligands: CA
Released: 4 Mar 2020

Explore 6UZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UZE contains 183 α-helices and 389 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 44 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	1
β-strand	201-205	5	1
α-helix	208-211	4
β-strand	219	1	1
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	2
β-strand	262-269	8	3
β-strand	272-273	2	4
β-strand	276-288	13	5
β-strand	291-304	14	5
β-strand	307-309	3	6
β-strand	318-320	3	6
β-strand	323-351	29	5
β-strand	358-360	3	4
β-strand	362-368	7	3
β-strand	374-385	12	7
β-strand	389-395	7	7
α-helix	398-400	3
β-strand	402-405	4	7
β-strand	409-411	3	3
α-helix	417-418	2
β-strand	419-421	3	3
β-strand	432-434	3	4
α-helix	436-445	10
β-strand	448-462	15	7
β-strand	469-476	8	7
α-helix	477-479	3
α-helix	481-484	4
β-strand	488-493	6	2
β-strand	503-506	4	2
β-strand	508	1	8
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	9
α-helix	523-530	8
β-strand	534	1	10
β-strand	541	1	10
β-strand	546	1	10
α-helix	547-549	3
β-strand	550-553	4	2
α-helix	556-569	14
α-helix	581	1
β-strand	582	1	9
α-helix	583	1
β-strand	584	1	8
β-strand	587-593	7	2
β-strand	596-598	3	11
β-strand	604-607	4	11
α-helix	610-614	5
β-strand	619-622	4	12
β-strand	626	1	13
β-strand	627-629	3	12
α-helix	635-637	3
β-strand	641-647	7	14
β-strand	654-655	2	14
β-strand	668	1	12
β-strand	674	1	12
β-strand	677	1	13
β-strand	695-701	7	14
β-strand	727-730	4	14

Chain B: 13 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	15
β-strand	201-205	5	15
α-helix	208-211	4
β-strand	219	1	15
α-helix	235-240	6
α-helix	249-252	4
β-strand	256	1	16
β-strand	262-269	8	17
β-strand	272-273	2	18
β-strand	276-286	11	5
β-strand	289-298	10	5
β-strand	302-303	2	5
β-strand	307-308	2	19
β-strand	311	1	6
β-strand	316	1	6
β-strand	318-321	4	19
β-strand	324-336	13	5
β-strand	339-353	15	5
β-strand	358-359	2	18
β-strand	362-368	7	17
β-strand	374-385	12	20
β-strand	389-390	2	20
β-strand	394-395	2	20
β-strand	402-405	4	20
β-strand	410-411	2	17
α-helix	417-418	2
β-strand	419-421	3	17
β-strand	433-434	2	18
α-helix	436-445	10
β-strand	448-462	15	20
β-strand	469-476	8	20
α-helix	481-487	7
β-strand	488-493	6	16
β-strand	501-506	6	16
α-helix	519-520	2
β-strand	522	1	21
α-helix	523-530	8
β-strand	534	1	22
β-strand	541	1	22
β-strand	546	1	22
α-helix	547-549	3
β-strand	550-554	5	16
α-helix	556-569	14
β-strand	582	1	21
β-strand	588-593	6	16
β-strand	597-598	2	23
β-strand	604-606	3	23
α-helix	610-614	5
β-strand	626	1	24
β-strand	629	1	25
β-strand	639-643	5	26
β-strand	645-646	2	27
β-strand	647	1	28
β-strand	654-655	2	27
β-strand	666-668	3	25
β-strand	674-676	3	25
β-strand	677	1	24
α-helix	678-681	4
β-strand	695	1	28
β-strand	698-702	5	26
β-strand	724-727	4	26

Chain C: 15 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	29
β-strand	201-205	5	29
α-helix	208-211	4
β-strand	219	1	29
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	30
β-strand	262-269	8	31
β-strand	272-273	2	32
β-strand	276-282	7	5
β-strand	285-297	13	5
β-strand	300-305	6	5
β-strand	306-311	6	19
β-strand	318-321	4	19
β-strand	327-330	4	33
β-strand	331-337	7	5
β-strand	341-350	10	5
β-strand	358-360	3	32
β-strand	362-368	7	31
β-strand	374-385	12	34
β-strand	389-395	7	34
α-helix	398-400	3
β-strand	402-405	4	34
β-strand	409-411	3	31
α-helix	417-418	2
β-strand	419-421	3	31
β-strand	432-434	3	32
α-helix	436-445	10
β-strand	448-462	15	34
β-strand	469-476	8	34
α-helix	477-479	3
α-helix	481-485	5
β-strand	488-493	6	30
β-strand	501-506	6	30
β-strand	508	1	35
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	36
α-helix	523-530	8
β-strand	534	1	37
β-strand	541-542	2	37
β-strand	545-546	2	37
α-helix	547-549	3
β-strand	550-554	5	30
α-helix	556-568	13
β-strand	582	1	36
β-strand	584	1	35
β-strand	587-593	7	30
β-strand	618-622	5	38
β-strand	626-630	5	38
β-strand	639-647	9	39
β-strand	654-655	2	39
β-strand	664	1	39
β-strand	666	1	38
β-strand	675-677	3	38
β-strand	695-702	8	39
β-strand	724	1	39
β-strand	729-730	2	39
α-helix	731-734	4

Chain D: 16 helices, 47 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	40
β-strand	201-205	5	40
α-helix	208-211	4
β-strand	219	1	40
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	41
β-strand	262-269	8	42
β-strand	272-273	2	43
β-strand	277-288	12	5
β-strand	290-293	4	5
β-strand	295	1	5
β-strand	296-302	7	33
β-strand	305	1	44
β-strand	308-310	3	45
β-strand	317-320	4	45
β-strand	322	1	44
β-strand	323-331	9	33
β-strand	332-351	20	5
β-strand	358-359	2	43
β-strand	362-368	7	42
β-strand	374-385	12	46
β-strand	389-394	6	46
α-helix	398-400	3
β-strand	402-405	4	46
β-strand	409-411	3	42
α-helix	417-418	2
β-strand	419-421	3	42
β-strand	433-434	2	43
α-helix	436-445	10
β-strand	448-462	15	46
β-strand	469-476	8	46
α-helix	481-485	5
β-strand	488-493	6	41
β-strand	501-506	6	41
β-strand	508	1	47
α-helix	519-520	2
β-strand	522	1	48
α-helix	523-530	8
β-strand	534	1	49
β-strand	541	1	49
β-strand	546	1	49
α-helix	547-549	3
β-strand	550-552	3	41
α-helix	556-569	14
α-helix	574-576	3
α-helix	581	1
β-strand	582	1	48
α-helix	583	1
β-strand	584	1	47
β-strand	588-593	6	41
β-strand	596-598	3	50
β-strand	604-607	4	50
β-strand	619-622	4	51
β-strand	626-629	4	51
α-helix	633-636	4
β-strand	639-647	9	52
β-strand	655	1	52
β-strand	667-668	2	51
β-strand	674-677	4	51
β-strand	695-702	8	52
β-strand	725-728	4	52

Chain E: 19 helices, 46 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	53
β-strand	201-205	5	53
α-helix	208-211	4
β-strand	219	1	53
α-helix	235-240	6
β-strand	256	1	54
β-strand	262-269	8	55
β-strand	272-273	2	56
β-strand	277-297	21	5
β-strand	300-306	7	33
β-strand	307-311	5	45
β-strand	316-320	5	45
β-strand	321-323	3	33
β-strand	325-330	6	33
β-strand	331-350	20	5
β-strand	358-359	2	56
β-strand	362-368	7	55
β-strand	374-380	7	57
β-strand	381-385	5	58
β-strand	389-394	6	58
α-helix	398-400	3
β-strand	402-405	4	57
β-strand	409-411	3	55
α-helix	417-418	2
β-strand	419-421	3	55
β-strand	433-434	2	56
α-helix	436-445	10
β-strand	448-450	3	58
β-strand	454-462	9	57
β-strand	469-476	8	57
α-helix	477-479	3
α-helix	481-484	4
β-strand	488-493	6	54
β-strand	501-506	6	54
β-strand	508	1	59
α-helix	515-517	3
α-helix	519-520	2
β-strand	522	1	60
α-helix	523-530	8
β-strand	534	1	61
β-strand	541	1	61
β-strand	546	1	61
α-helix	547-549	3
β-strand	550-552	3	54
α-helix	556-568	13
α-helix	574-576	3
α-helix	581	1
β-strand	582	1	60
α-helix	583	1
β-strand	584	1	59
β-strand	588-593	6	54
β-strand	596-598	3	62
β-strand	604-607	4	62
α-helix	611-614	4
β-strand	622	1	63
β-strand	626-629	4	63
α-helix	633-636	4
β-strand	639-647	9	64
β-strand	655	1	64
β-strand	667-668	2	63
β-strand	674-677	4	63
β-strand	695-702	8	64
α-helix	721-723	3
β-strand	729-730	2	64

Chain F: 17 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	65
β-strand	201-205	5	65
α-helix	208-213	6
β-strand	219	1	65
α-helix	235-240	6
β-strand	256	1	66
β-strand	262-273	12	67
β-strand	277-286	10	5
β-strand	287	1	68
β-strand	289-296	8	5
β-strand	299-309	11	33
β-strand	318-328	11	33
β-strand	331-337	7	5
β-strand	340	1	68
β-strand	342-351	10	5
β-strand	358-368	11	67
β-strand	374	1	69
β-strand	375-376	2	70
β-strand	377	1	71
β-strand	378-385	8	70
β-strand	389-395	7	70
α-helix	398-400	3
β-strand	402	1	71
β-strand	405	1	69
β-strand	409-411	3	67
α-helix	417-418	2
β-strand	419-421	3	67
β-strand	433-434	2	67
α-helix	436-445	10
β-strand	448-450	3	70
β-strand	454-462	9	70
β-strand	469-476	8	70
α-helix	481-484	4
β-strand	488-493	6	66
β-strand	501-506	6	66
α-helix	519-520	2
β-strand	522	1	72
α-helix	523-530	8
β-strand	534	1	73
β-strand	541	1	73
β-strand	546	1	73
α-helix	547-549	3
β-strand	550-552	3	66
α-helix	557-567	11
α-helix	574-576	3
α-helix	578-580	3
β-strand	582	1	72
β-strand	588-593	6	66
β-strand	598	1	74
β-strand	604	1	74
α-helix	609-612	4
β-strand	619-622	4	75
β-strand	626-629	4	75
α-helix	635-638	4
β-strand	639-647	9	76
β-strand	654	1	76
β-strand	666-668	3	75
β-strand	674-677	4	75
β-strand	695-702	8	76
α-helix	703-705	3
α-helix	731-734	4

Chain G: 19 helices, 49 β-strands

Element	Residues	Length	Sheet
α-helix	185-190	6
β-strand	192-196	5	77
β-strand	201-205	5	77
α-helix	208-211	4
β-strand	219	1	77
α-helix	235-240	6
α-helix	249-251	3
β-strand	256	1	78
β-strand	262-269	8	79
β-strand	272-273	2	80
β-strand	277-287	11	5
β-strand	289-298	10	5
α-helix	300	1
β-strand	301-303	3	33
β-strand	306-311	6	33
β-strand	318-319	2	33
β-strand	324-325	2	33
β-strand	326-338	13	5
β-strand	341-342	2	5
β-strand	345-351	7	5
β-strand	358-359	2	80
β-strand	362-368	7	79
β-strand	374-385	12	81
β-strand	389-395	7	81
β-strand	404-405	2	81
β-strand	409-411	3	79
α-helix	417-418	2
β-strand	419-421	3	79
β-strand	433-434	2	80
α-helix	436-445	10
β-strand	448-458	11	81
β-strand	459-462	4	82
β-strand	469-472	4	82
α-helix	477-479	3
α-helix	481-485	5
β-strand	489-493	5	78
β-strand	503-505	3	78
β-strand	508	1	83
α-helix	514-517	4
α-helix	519-520	2
β-strand	522	1	84
α-helix	523-530	8
β-strand	534	1	85
β-strand	541	1	85
β-strand	546	1	85
α-helix	547-549	3
β-strand	550-554	5	78
α-helix	556-569	14
α-helix	574-576	3
α-helix	578-580	3
β-strand	582	1	84
β-strand	584	1	83
β-strand	587-593	7	78
β-strand	596-598	3	86
β-strand	604-607	4	86
β-strand	622	1	87
β-strand	626-627	2	87
α-helix	633-636	4
β-strand	639	1	88
β-strand	643-646	4	89
α-helix	660-662	3
β-strand	668	1	90
β-strand	674	1	90
β-strand	676-677	2	87
β-strand	696-699	4	89
β-strand	702	1	88
α-helix	718-720	3
β-strand	725-729	5	89

Chain H: 33 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	22-28	7
β-strand	34	1	15
α-helix	42-53	12
α-helix	58-66	9
β-strand	70-74	5	91
β-strand	95	1	92
β-strand	101	1	92
β-strand	109-112	4	91
β-strand	118-122	5	91
α-helix	132-143	12
α-helix	146-149	4
β-strand	150	1	93
β-strand	155	1	93
α-helix	157-168	12
α-helix	172-176	5
α-helix	179-188	10
α-helix	194-199	6
α-helix	201-216	16
α-helix	221-227	7
α-helix	229-237	9
α-helix	238-242	5
α-helix	243-252	10
α-helix	266-269	4
α-helix	276-289	14
β-strand	293-295	3	94
α-helix	300-307	8
β-strand	311-312	2	95
α-helix	331-332	2
α-helix	335-337	3
α-helix	346-360	15
β-strand	362	1	96
β-strand	365	1	96
β-strand	368	1	97
α-helix	375-379	5
β-strand	387	1	98
β-strand	394	1	99
β-strand	397	1	99
β-strand	401-402	2	100
β-strand	403	1	98
β-strand	411-412	2	100
β-strand	413	1	101
β-strand	420	1	101
β-strand	443	1	97
β-strand	445	1	102
β-strand	448	1	103
β-strand	451	1	103
β-strand	454	1	102
β-strand	455-456	2	95
α-helix	457-459	3
β-strand	463	1	94
α-helix	480-483	4
α-helix	489-503	15
β-strand	508-509	2	104
β-strand	515-516	2	104
α-helix	518-529	12
β-strand	561-563	3	94
β-strand	570-571	2	94
α-helix	575-581	7
α-helix	582-586	5
α-helix	627-636	10
α-helix	653-671	19
α-helix	681-703	23
α-helix	710-732	23
β-strand	738	1	91
α-helix	740-746	7
α-helix	756-764	9

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protective antigen	A, B, C, D, E, F, G	protein	735	Bacillus anthracis	P13423 (AlphaFold model)
Calmodulin-sensitive adenylate cyclase	H, I	protein	767	Bacillus anthracis	P40136 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>6UZE_1 Protective antigen (chains A, B, C, D, E, F, G)
EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF
QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY
QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDN
DGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVT
GRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHT
SEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARL
NANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIA
LNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEV
LPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNL
QYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDR
NNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRY
DMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNG
IKKILIFSKKGYEIG

Sequence of entity 2 (H, I), FASTA

>6UZE_2 Calmodulin-sensitive adenylate cyclase (chains H, I)
MNEHYTESDIKRNHKTEKNKTEKEKFKDSINNLVKTEFTNETLDKIQQTQDLLKKIPKDV
LEIYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFVFEKKRETPKLI
INIKDYAINSEQSKEVYYEIGKGISLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQK
FKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYMNKLEK
GGFEKISESLKKEGVEKDRIDVLKGEKALKASGLVPEHADAFKKIARELNTYILFRPVNK
LATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQQLAVEKGNLENKKSITE
HEGEIGKIPLKLDHLRIEELKENGIILKGKKEIDNGKKYYLLESNNQVYEFRISDENNEV
QYKTKEGKITVLGEKFNWRNIEVMAKNVEGVLKPLTADYDLFALAPSLTEIKKQIPQKEW
DKVVNTPNSLEKQKGVTNLLIKYGIERKPDSTKGTLSNWQKQMLDRLNEAVKYTGYTGGD
VVNHGTEQDNEEFPEKDNEIFIINPEGEFILTKNWEMTGRFIEKNITGKDYLYYFNRSYN
KIAPGNKAYIEWTDPITKAKINTIPTSAEFIKNLSSIRRSSNVGVYKDSGDKDEFAKKES
VKKIAGYLSDYYNSANHIFSQEKKRKISIFRGIQAYNEIENVLKSKQIAPEYKNYFQYLK
ERITNQVQLLLTHQKSNIEFKLLYKQLNFTENETDNFEVFQKIIDEK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	14

Primary citation

Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors. Hardenbrook, N.J., Liu, S., Zhou, K. et al. Nat Commun (2020) 11:840-840. DOI 10.1038/s41467-020-14658-6 · PubMed

Other PDB entries of the same protein (UniProt P13423 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TEW 1.45 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4H2A 1.62 Å, Crystal structure of wild type protective antigen to 1.62 A (pH 7.5)
3MHZ 1.7 Å, 1.7A structure of 2-fluorohistidine labeled Protective Antigen
3TEX 1.7 Å, Crystal Structure of Anthrax Protective Antigen (Membrane Insertion Loop Deleted) to…
4NAM 1.7 Å, 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y)
3TEZ 1.83 Å, Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone…
4EE2 1.91 Å, Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution
5FR3 1.94 Å, X-ray crystal structure of aggregation-resistant protective antigen of Bacillus…
3INO 1.95 Å, 1.95A Resolution Structure of Protective Antigen Domain 4
3Q8B 2.0 Å, Crystal structure of WT Protective Antigen (pH 9.0)
3Q8E 2.1 Å, Crystal structure of Protective Antigen W346F (pH 8.5)
1ACC 2.1 Å, Anthrax protective antigen

Browse structure collections

About this viewer

MolViewer shows 6UZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.