N-terminal 5 domains of CI-MPR. Determined by X-ray diffraction at 2.46 Å resolution. Released 30 Sept 2020.
Explore 6V02 in 3D Show helices and sheets RCSB PDB PDBe
6V02 contains 12 α-helices and 55 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-13 | 3 | |
| β-strand | 18-22 | 5 | 1 |
| β-strand | 27-31 | 5 | 1 |
| β-strand | 46-50 | 5 | 1 |
| β-strand | 59-63 | 5 | 1 |
| β-strand | 67-70 | 4 | 2 |
| β-strand | 73-77 | 5 | 2 |
| β-strand | 92-99 | 8 | 2 |
| β-strand | 106-111 | 6 | 2 |
| β-strand | 115-122 | 8 | 2 |
| α-helix | 123-125 | 3 | |
| β-strand | 136 | 1 | 3 |
| β-strand | 140-141 | 2 | 4 |
| β-strand | 149-150 | 2 | 4 |
| α-helix | 152-154 | 3 | |
| β-strand | 161-163 | 3 | 5 |
| β-strand | 164 | 1 | 6 |
| β-strand | 171-174 | 4 | 5 |
| β-strand | 178 | 1 | 3 |
| α-helix | 179-181 | 3 | |
| β-strand | 199-202 | 4 | 5 |
| β-strand | 207-211 | 5 | 5 |
| β-strand | 212 | 1 | 6 |
| β-strand | 218-220 | 3 | 6 |
| β-strand | 224-230 | 7 | 6 |
| β-strand | 246-252 | 7 | 6 |
| β-strand | 264-267 | 4 | 6 |
| α-helix | 269-271 | 3 | |
| β-strand | 272-278 | 7 | 6 |
| α-helix | 280-282 | 3 | |
| β-strand | 287-290 | 4 | 7 |
| β-strand | 294 | 1 | 8 |
| β-strand | 305 | 1 | 8 |
| β-strand | 317 | 1 | 9 |
| β-strand | 320 | 1 | 9 |
| β-strand | 324-328 | 5 | 9 |
| β-strand | 346-350 | 5 | 9 |
| β-strand | 357-359 | 3 | 9 |
| β-strand | 366-371 | 6 | 7 |
| β-strand | 374-379 | 6 | 7 |
| β-strand | 384 | 1 | 10 |
| α-helix | 389 | 1 | |
| β-strand | 390 | 1 | 10 |
| α-helix | 391 | 1 | |
| β-strand | 392-399 | 8 | 7 |
| β-strand | 409-417 | 9 | 7 |
| β-strand | 420-427 | 8 | 7 |
| α-helix | 428-430 | 3 | |
| β-strand | 443 | 1 | 11 |
| β-strand | 448 | 1 | 11 |
| β-strand | 587-588 | 2 | 12 |
| β-strand | 593-595 | 3 | 13 |
| β-strand | 602-604 | 3 | 13 |
| α-helix | 606-608 | 3 | |
| β-strand | 615-618 | 4 | 14 |
| β-strand | 622 | 1 | 15 |
| β-strand | 623-626 | 4 | 14 |
| α-helix | 631-632 | 2 | |
| β-strand | 641-646 | 6 | 14 |
| β-strand | 647 | 1 | 15 |
| β-strand | 653-658 | 6 | 14 |
| β-strand | 664-666 | 3 | 12 |
| β-strand | 669-674 | 6 | 12 |
| β-strand | 690-696 | 7 | 12 |
| β-strand | 705-708 | 4 | 12 |
| β-strand | 716-721 | 6 | 12 |
| α-helix | 722-724 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cation-independent mannose-6-phosphate receptor | A | protein | 731 | Homo sapiens | P11717 (AlphaFold model) |
>6V02_1 Cation-independent mannose-6-phosphate receptor (chains A) GSTQAAPFPELCSYTWEAVDTKNNVLYKINICGSVDIVQCGPSSAVCMHDLKTRTYHSVG DSVLRSATRSLLEFNTTVSCDQQGTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRT TAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDT LRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDG HSPAVTITFVCPSERREGTIPKLTAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDV SIDLTPLAQSGGSSYISDGKEYLFYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGR YHNQTLRYSDGDLTLIYFGGDECSSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYF FTWDTEYACVKEKEDLLCGATDGKKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFIN ICHRVLQEGKARGCPEDAAVCAVDKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKK IKTNITLVCKPGDLESAPVLRTSGEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFS FDLSPLTKKNGAYKVETKKYDFYINVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAK LSYYDGMIQLNYRGGTPYNNERHTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTS YACPEEALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Allosteric regulation of lysosomal enzyme recognition by the cation-independent mannose 6-phosphate receptor. Olson, L.J., Misra, S.K., Ishihara, M. et al. Commun Biol (2020) 3:498-498. DOI 10.1038/s42003-020-01211-w · PubMed
Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6V02 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.