6V7M: Apolipoprotein E

Crystal structure of a proteolytically cleaved, amino terminal domain of apolipoprotein E3. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Mar 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,316
Mol. weight: 21.33 kDa
Ligands: PO4
Released: 11 Mar 2020

Explore 6V7M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V7M contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	25-40	16
α-helix	45-52	8
α-helix	55-78	24

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	87-91	5
α-helix	94-124	31
α-helix	131-163	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein E	A	protein	100	Homo sapiens	P02649 (AlphaFold model)
Apolipoprotein E	B	protein	83	Homo sapiens	P02649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6V7M_1 Apolipoprotein E (chains A)
MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQT
LSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQL

Sequence of entity 2 (B), FASTA

>6V7M_2 Apolipoprotein E (chains B)
TPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLR
KLRKRLLRDADDLQKRLAVYQAG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Primary citation

Crystal structure of a proteolytically cleaved, amino terminal domain of apolipoprotein E3. McPherson, A. Biochem Biophys Res Commun (2020). DOI 10.1016/j.bbrc.2020.01.117 · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)

Browse structure collections

About this viewer

MolViewer shows 6V7M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.