Crystal structure of SUMO1 in complex with phosphorylated PIAS-SIM2. Determined by X-ray diffraction at 1.35 Å resolution. Released 1 Apr 2020.
Explore 6V7Q in 3D Show helices and sheets RCSB PDB PDBe
6V7Q contains 8 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 2 |
| β-strand | 33-39 | 7 | 2 |
| α-helix | 45-55 | 11 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-66 | 5 | 2 |
| β-strand | 69-70 | 2 | 2 |
| α-helix | 77-80 | 4 | |
| β-strand | 87-92 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-9 | 4 | |
| β-strand | 11-13 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| β-strand | 33-39 | 7 | 1 |
| α-helix | 45-55 | 11 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 71-72 | 2 | |
| α-helix | 77-80 | 4 | |
| β-strand | 87-92 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-13 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small ubiquitin-related modifier 1 | A, C | protein | 83 | Homo sapiens | P63165 (AlphaFold model) |
| Protein PIAS | B, D | protein | 13 | Homo sapiens |
>6V7Q_1 Small ubiquitin-related modifier 1 (chains A, C) GSKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADN HTPKELGMEEEDVIEVYQEQTGG
>6V7Q_2 Protein PIAS (chains B, D) GSGEAEERIISLD
Characterization of a C-Terminal SUMO-Interacting Motif Present in Select PIAS-Family Proteins. Lussier-Price, M., Mascle, X.H., Cappadocia, L. et al. Structure (2020) 28:573-585.e5. DOI 10.1016/j.str.2020.04.002 · PubMed
Other PDB entries of the same protein (UniProt P63165 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6V7Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.