6V7S: K37-acetylated SUMO1

Crystal structure of K37-acetylated SUMO1 in complex with phosphorylated PIAS-SIM2. Determined by X-ray diffraction at 1.47 Å resolution. Released 1 Apr 2020.

Method: X-ray diffraction
Resolution: 1.47 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,683
Mol. weight: 22.05 kDa
Released: 1 Apr 2020

Explore 6V7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V7S contains 10 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	2
β-strand	33-39	7	2
α-helix	45-55	11
α-helix	59-61	3
β-strand	62-66	5	2
β-strand	69-70	2	2
α-helix	71-72	2
α-helix	77-80	4
β-strand	87-92	6	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11-13	3	2

Chain C: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
β-strand	33-38	6	1
α-helix	45-55	11
α-helix	59-61	3
β-strand	62-66	5	1
β-strand	69-70	2	1
α-helix	71-72	2
α-helix	77-80	4
β-strand	87-92	6	1

Chain D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	11-13	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small ubiquitin-related modifier 1	A, C	protein	83	Homo sapiens	P63165 (AlphaFold model)
Protein PIAS	B, D	protein	13	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>6V7S_1 Small ubiquitin-related modifier 1 (chains A, C)
GSKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYAQRQGVPMNSLRFLFEGQRIADN
HTPKELGMEEEDVIEVYQEQTGG

Sequence of entity 2 (B, D), FASTA

>6V7S_2 Protein PIAS (chains B, D)
GSGEAEERIISLD

Primary citation

Characterization of a C-Terminal SUMO-Interacting Motif Present in Select PIAS-Family Proteins. Lussier-Price, M., Mascle, X.H., Cappadocia, L. et al. Structure (2020) 28:573-585.e5. DOI 10.1016/j.str.2020.04.002 · PubMed

Other PDB entries of the same protein (UniProt P63165 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UYR 1.3 Å, Crystal structure of K46-acetylated SUMO1 in complex with PML-SIM
4WJQ 1.35 Å, Crystal Structure of SUMO1 in complex with Daxx
6V7Q 1.35 Å, Crystal structure of SUMO1 in complex with phosphorylated PIAS-SIM2
6V7P 1.4 Å, Crystal structure of SUMO1 in complex with PIAS-SIM2
2UYZ 1.4 Å, Non-covalent complex between Ubc9 and SUMO1
6UYZ 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated DAXX
6UYV 1.4 Å, Crystal structure of K46-acetylated SUMO1 in complex with phosphorylated PML-SIM
6UYP 1.42 Å, Crystal structure of K39-acetylated SUMO1 in complex with PML-SIM
4WJO 1.46 Å, Crystal Structure of SUMO1 in complex with PML
4WJN 1.5 Å, Crystal structure of SUMO1 in complex with phosphorylated PML
6UYQ 1.5 Å, Crystal structure of K45-acetylated SUMO1 in complex with PML-SIM
6V7R 1.55 Å, Crystal structure of K37-acetylated SUMO1 in complex with PIAS-SIM2

Browse structure collections

About this viewer

MolViewer shows 6V7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.