6V8G: GltPh mutant - Y204L A345V V366A

GltPh mutant - Y204L A345V V366A. Determined by X-ray diffraction at 3.38 Å resolution. Released 18 Nov 2020.

Method: X-ray diffraction
Resolution: 3.38 Å
Organism: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Chains: 3
Atoms: 8,679
Mol. weight: 134.38 kDa
Ligands: ASP
Released: 18 Nov 2020

Explore 6V8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V8G contains 66 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	15-33	19
α-helix	36-42	7
α-helix	44-72	29
α-helix	75-106	32
α-helix	131-135	5
α-helix	142-147	6
α-helix	151-169	19
α-helix	174-201	28
α-helix	202-204	3
α-helix	205-220	16
α-helix	227-242	16
α-helix	243-248	6
α-helix	249-253	5
α-helix	258-275	18
α-helix	278-291	14
α-helix	296-309	14
α-helix	312-328	17
α-helix	332-334	3
α-helix	335-351	17
α-helix	358-369	12
α-helix	377-387	11
α-helix	390-414	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate transporter homolog	A, B, C	protein	422	Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)	O59010 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>6V8G_1 Glutamate transporter homolog (chains A, B, C)
MGLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMP
IVFASLVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQ
QFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSA
ETLLDAINGLAEAMYKIVNGVMQLAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLT
LQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYS
FTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTVVLASIGTAGVPGAGA
IMLAMALHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLV
PR

Ligands and cofactors

ID	Name	Formula	Copies
ASP	Aspartic acid	C4 H7 N O4	3

Water and common crystallization additives (NA) are not listed.

Primary citation

The high-energy transition state of the glutamate transporter homologue GltPh. Huysmans, G.H.M., Ciftci, D., Wang, X. et al. EMBO J (2021) 40:e105415-e105415. DOI 10.15252/embj.2020105415 · PubMed

Other PDB entries of the same protein (UniProt O59010 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RCP 2.2 Å, GltPh mutant (S279E/D405N) in complex with aspartate and sodium ions
7AHK 2.5 Å, Crystal structure of the outward-facing state of the substrate-free Na+-only bound…
7UG0 2.55 Å, TBOA-bound GltPh RSMR mutant in IFS state
9BH2 2.7 Å, Apo GltPh, outward-facing state
7UGJ 2.81 Å, TBOA-bound GltPh RSMR mutant in OFS state
7UGV 2.94 Å, Asp-bound GltPh RSMR mutant in IFS-A2 state
7UGD 2.95 Å, Asp-bound GltPh RSMR mutant in IFS-A1 state
2NWL 2.96 Å, Crystal structure of GltPh in complex with L-Asp
7UGX 2.96 Å, Asp-bound GltPh RSMR mutant in IFS-B1 state
7UH3 2.99 Å, Asp-bound GltPh RSMR mutant in iOFS state
6X15 3.05 Å, Inward-facing state of the glutamate transporter homologue GltPh in complex with…
6UWF 3.08 Å, GltPh in complex with L-aspartate and sodium ions in outward-facing state

Browse structure collections

About this viewer

MolViewer shows 6V8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.