X-ray structure of ALKS 4230, a fusion of circularly permuted human Interleukin-2 and Interleukin-2 Receptor alpha. Determined by X-ray diffraction at 3.4 Å resolution. Released 29 Apr 2020.
Explore 6VWU in 3D Show helices and sheets RCSB PDB PDBe
6VWU contains 13 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-23 | 16 | |
| α-helix | 29-31 | 3 | |
| β-strand | 33 | 1 | 1 |
| β-strand | 38 | 1 | 2 |
| α-helix | 40-56 | 17 | |
| α-helix | 63-84 | 22 | |
| α-helix | 91-97 | 7 | |
| β-strand | 102 | 1 | 2 |
| β-strand | 105 | 1 | 1 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-119 | 6 | |
| α-helix | 121-130 | 10 | |
| β-strand | 140 | 1 | 3 |
| α-helix | 144-147 | 4 | |
| β-strand | 148 | 1 | 4 |
| β-strand | 151-155 | 5 | 4 |
| β-strand | 158 | 1 | 5 |
| β-strand | 163-165 | 3 | 6 |
| β-strand | 172-174 | 3 | 7 |
| α-helix | 175 | 1 | |
| β-strand | 181-183 | 3 | 6 |
| β-strand | 184-185 | 2 | 8 |
| β-strand | 192-193 | 2 | 8 |
| β-strand | 199-201 | 3 | 7 |
| β-strand | 242 | 1 | 5 |
| α-helix | 244-247 | 4 | |
| β-strand | 257-258 | 2 | 6 |
| α-helix | 259 | 1 | |
| β-strand | 260 | 1 | 3 |
| β-strand | 264-269 | 6 | 4 |
| α-helix | 270 | 1 | |
| β-strand | 274-275 | 2 | 9 |
| β-strand | 282-284 | 3 | 4 |
| β-strand | 285-287 | 3 | 10 |
| β-strand | 292-294 | 3 | 10 |
| β-strand | 301-302 | 2 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-2,Interleukin-2 receptor subunit alpha | A | protein | 303 | Homo sapiens | P01589 (AlphaFold model), P60568 (AlphaFold model) |
>6VWU_1 Interleukin-2,Interleukin-2 receptor subunit alpha (chains A) SKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFSQSIISTLTG GSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEE LKPLEEVLNLAQGSGGGSELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSL YMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPG HCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLI CTG
ALKS 4230: a novel engineered IL-2 fusion protein with an improved cellular selectivity profile for cancer immunotherapy. Lopes, J.E., Fisher, J.L., Flick, H.L. et al. J Immunother Cancer (2020) 8. DOI 10.1136/jitc-2020-000673 · PubMed
Other PDB entries of the same protein (UniProt P01589 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6VWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.