Crystal structure of SARS-CoV-2 receptor binding domain in complex with human antibody CR3022. Determined by X-ray diffraction at 3.08 Å resolution. Released 25 Mar 2020.
Explore 6W41 in 3D Show helices and sheets RCSB PDB PDBe
6W41 contains 20 α-helices and 61 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 334-335 | 2 | 12 |
| α-helix | 338-342 | 5 | |
| β-strand | 354-358 | 5 | 13 |
| β-strand | 361-362 | 2 | 12 |
| α-helix | 366-370 | 5 | |
| β-strand | 376-379 | 4 | 13 |
| β-strand | 391-392 | 2 | 12 |
| β-strand | 394-403 | 10 | 13 |
| α-helix | 404-409 | 6 | |
| α-helix | 417-421 | 5 | |
| β-strand | 431-437 | 7 | 13 |
| β-strand | 448 | 1 | 14 |
| β-strand | 452-454 | 3 | 15 |
| α-helix | 460-462 | 3 | |
| α-helix | 471-472 | 2 | |
| β-strand | 473-474 | 2 | 16 |
| β-strand | 485 | 1 | 16 |
| β-strand | 488-489 | 2 | 16 |
| β-strand | 492-494 | 3 | 15 |
| β-strand | 497 | 1 | 14 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-516 | 10 | 13 |
| α-helix | 521-522 | 2 | |
| β-strand | 524-525 | 2 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 33-39 | 7 | 2 |
| β-strand | 45-52 | 8 | 2 |
| β-strand | 56-59 | 4 | 2 |
| β-strand | 68-72 | 5 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 2 |
| β-strand | 102-103 | 2 | 2 |
| β-strand | 107-111 | 5 | 2 |
| β-strand | 117 | 1 | 3 |
| β-strand | 120-124 | 5 | 4 |
| α-helix | 125-127 | 3 | |
| β-strand | 135-145 | 11 | 4 |
| β-strand | 146 | 1 | 3 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 5 |
| β-strand | 163-165 | 3 | 4 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 176-185 | 10 | 4 |
| α-helix | 186-189 | 4 | |
| β-strand | 194-200 | 7 | 5 |
| β-strand | 205-211 | 7 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 27D | 1 | 8 |
| β-strand | 30 | 1 | 8 |
| β-strand | 33-38 | 6 | 7 |
| α-helix | 43-44 | 2 | |
| β-strand | 45-49 | 5 | 7 |
| β-strand | 53-54 | 2 | 7 |
| β-strand | 62-67 | 6 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 7 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 7 |
| β-strand | 102-106 | 5 | 7 |
| β-strand | 111 | 1 | 9 |
| β-strand | 114-118 | 5 | 10 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-127 | 6 | |
| β-strand | 129-139 | 11 | 10 |
| β-strand | 140 | 1 | 9 |
| β-strand | 145-150 | 6 | 11 |
| β-strand | 153-155 | 3 | 11 |
| β-strand | 159-163 | 5 | 10 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 10 |
| α-helix | 183-187 | 5 | |
| β-strand | 191-197 | 7 | 11 |
| β-strand | 205-210 | 6 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CR3022 Fab heavy chain | H | protein | 222 | Homo sapiens | |
| CR3022 Fab light chain | L | protein | 221 | Homo sapiens | |
| Spike protein S1 | C | protein | 231 | Severe acute respiratory syndrome coronavirus 2 | P0DTC2 (AlphaFold model) |
>6W41_1 CR3022 Fab heavy chain (chains H) QMQLVQSGTEVKKPGESLKISCKGSGYGFITYWIGWVRQMPGKGLEWMGIIYPGDSETRY SPSFQGQVTISADKSINTAYLQWSSLKASDTAIYYCAGGSGISTPMDVWGQGTTVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>6W41_2 CR3022 Fab light chain (chains L) DIQLTQSPDSLAVSLGERATINCKSSQSVLYSSINKNYLAWYQQKPGQPPKLLIYWASTR ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKVEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECS
>6W41_3 Spike protein S1 (chains C) RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFSGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Water and common crystallization additives (GOL, SO4) are not listed.
A highly conserved cryptic epitope in the receptor binding domains of SARS-CoV-2 and SARS-CoV. Yuan, M., Wu, N.C., Zhu, X. et al. Science (2020) 368:630-633. DOI 10.1126/science.abb7269 · PubMed
Other PDB entries of the same protein (UniProt P0DTC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
6W41 is part of these collections:
MolViewer shows 6W41 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.