1.80 Angstrom Resolution Crystal Structure of NSP16 - NSP10 Complex from SARS-CoV-2. Determined by X-ray diffraction at 1.8 Å resolution. Released 18 Mar 2020.
Explore 6W4H in 3D Show helices and sheets RCSB PDB PDBe
6W4H contains 27 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6800-6803 | 4 | |
| β-strand | 6806-6808 | 3 | 1 |
| α-helix | 6809-6810 | 2 | |
| α-helix | 6811-6814 | 4 | |
| α-helix | 6818-6820 | 3 | |
| α-helix | 6834-6835 | 2 | |
| α-helix | 6840-6852 | 13 | |
| β-strand | 6864-6868 | 5 | 1 |
| β-strand | 6876 | 1 | 2 |
| α-helix | 6878-6886 | 9 | |
| α-helix | 6888 | 1 | |
| β-strand | 6892-6897 | 6 | 1 |
| β-strand | 6902 | 1 | 2 |
| β-strand | 6907-6910 | 4 | 1 |
| α-helix | 6913-6915 | 3 | |
| β-strand | 6916-6918 | 3 | 3 |
| β-strand | 6922-6927 | 6 | 1 |
| α-helix | 6932-6934 | 3 | |
| α-helix | 6942-6944 | 3 | |
| α-helix | 6947-6958 | 12 | |
| β-strand | 6959-6960 | 2 | 1 |
| β-strand | 6961 | 1 | 4 |
| β-strand | 6962-6969 | 8 | 1 |
| α-helix | 6976-6982 | 7 | |
| β-strand | 6985-6993 | 9 | 1 |
| α-helix | 6994-6996 | 3 | |
| β-strand | 7002-7009 | 8 | 1 |
| α-helix | 7019-7032 | 14 | |
| α-helix | 7040-7043 | 4 | |
| α-helix | 7050-7051 | 2 | |
| β-strand | 7056-7058 | 3 | 4 |
| α-helix | 7062-7064 | 3 | |
| α-helix | 7067-7074 | 8 | |
| β-strand | 7078-7080 | 3 | 4 |
| β-strand | 7088-7090 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4276-4285 | 10 | |
| α-helix | 4288-4291 | 4 | |
| β-strand | 4296 | 1 | 5 |
| α-helix | 4297-4298 | 2 | |
| β-strand | 4308-4309 | 2 | 5 |
| β-strand | 4318-4322 | 5 | 5 |
| α-helix | 4324-4326 | 3 | |
| α-helix | 4328-4332 | 5 | |
| α-helix | 4339-4341 | 3 | |
| β-strand | 4349-4353 | 5 | 5 |
| α-helix | 4354-4356 | 3 | |
| α-helix | 4360-4366 | 7 | |
| β-strand | 4369 | 1 | 6 |
| β-strand | 4376-4377 | 2 | 6 |
| β-strand | 4379-4381 | 3 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 2'-O-methyltransferase | A | protein | 301 | Severe acute respiratory syndrome coronavirus 2 | P0DTD1 (AlphaFold model) |
| Non-structural protein 10 | B | protein | 142 | Severe acute respiratory syndrome coronavirus 2 | P0DTD1 (AlphaFold model) |
>6W4H_1 2'-O-methyltransferase (chains A) SNASSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTL TLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCAT VHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWN ADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPI QLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVN N
>6W4H_2 Non-structural protein 10 (chains B) SNAAGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITV TPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVC TVCGMWKGYGCSCDQLREPMLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| SO3 | Sulfite ion | O3 S | 1 |
| SAM | S-adenosylmethionine | C15 H22 N6 O5 S | 1 |
| BDF | beta-D-fructopyranose | C6 H12 O6 | 2 |
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (ACT) are not listed.
High-resolution structures of the SARS-CoV-2 2'- O -methyltransferase reveal strategies for structure-based inhibitor design. Rosas-Lemus, M., Minasov, G., Shuvalova, L. et al. Sci Signal (2020) 13. DOI 10.1126/scisignal.abe1202 · PubMed
Other PDB entries of the same protein (UniProt P0DTD1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
6W4H is part of these collections:
MolViewer shows 6W4H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.