6W6W: CST

Cryo-EM structure of CST bound to telomeric single-stranded DNA. Determined by electron microscopy at 3.0 Å resolution. Released 3 Jun 2020.

Method: Electron microscopy
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 5
Atoms: 10,981
Mol. weight: 335.08 kDa
Ligands: ZN
Released: 3 Jun 2020

Explore 6W6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W6W contains 53 α-helices and 88 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 67 β-strands

Element	Residues	Length	Sheet
β-strand	164	1	1
β-strand	165-166	2	2
β-strand	178-179	2	2
α-helix	184-186	3
β-strand	228-229	2	3
β-strand	230	1	4
β-strand	245-249	5	4
β-strand	260-264	5	4
α-helix	269-272	4
β-strand	280-281	2	3
β-strand	287-288	2	4
β-strand	299-300	2	4
β-strand	351-352	2	5
β-strand	354-356	3	6
β-strand	361	1	7
β-strand	364-367	4	6
β-strand	372-374	3	6
β-strand	380-381	2	6
β-strand	400-403	4	7
β-strand	406-409	4	6
β-strand	413	1	8
β-strand	420-422	3	6
β-strand	429-433	5	7
α-helix	438-439	2
α-helix	450-458	9
α-helix	464-473	10
α-helix	488-491	4
α-helix	493-495	3
α-helix	502-505	4
α-helix	508-511	4
α-helix	525-527	3
β-strand	539-540	2	5
β-strand	543	1	8
α-helix	554-557	4
α-helix	569-572	4
α-helix	577-579	3
α-helix	583-586	4
β-strand	592-597	6	9
β-strand	608-614	7	10
β-strand	621-624	4	10
β-strand	629-631	3	10
β-strand	632-637	6	9
β-strand	640-641	2	9
α-helix	645-647	3
β-strand	650-654	5	10
β-strand	658-667	10	9
α-helix	672-674	3
β-strand	681-693	13	9
β-strand	697-701	5	10
α-helix	702-704	3
β-strand	728-738	11	11
β-strand	742-744	3	11
β-strand	746	1	12
α-helix	747-749	3
α-helix	756-759	4
β-strand	760-769	10	11
β-strand	774-775	2	11
β-strand	776-777	2	13
β-strand	780-781	2	13
α-helix	783-786	4
β-strand	795-801	7	11
α-helix	802-810	9
β-strand	816-822	7	11
β-strand	842	1	12
α-helix	843-845	3
β-strand	851-853	3	11
α-helix	854-855	2
β-strand	859-862	4	11
α-helix	884-886	3
β-strand	896-907	12	14
β-strand	929-935	7	14
β-strand	945-950	6	14
α-helix	952-954	3
β-strand	966-976	11	14
β-strand	981	1	15
β-strand	982-985	4	14
β-strand	992-994	3	14
α-helix	997-999	3
α-helix	1012-1015	4
β-strand	1024-1025	2	16
β-strand	1028-1038	11	16
β-strand	1041-1042	2	17
β-strand	1068-1069	2	17
β-strand	1072-1078	7	16
β-strand	1083	1	16
β-strand	1085-1088	4	16
α-helix	1101-1107	7
β-strand	1118-1119	2	16
α-helix	1141-1145	5
β-strand	1154-1161	8	16
β-strand	1167	1	15
α-helix	1169-1171	3
β-strand	1175-1177	3	18
β-strand	1180-1181	2	19
β-strand	1184-1185	2	19
β-strand	1188-1190	3	18
α-helix	1191-1194	4
β-strand	1195-1203	9	16

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	19	1	1

Chain C: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
α-helix	21-24	4
β-strand	27	1	20
α-helix	31-34	4
α-helix	37	1
β-strand	38-39	2	21
α-helix	40	1
β-strand	47-49	3	21
β-strand	52-54	3	21
β-strand	57-65	9	20
β-strand	68	1	20
β-strand	73-78	6	20
β-strand	83-88	6	20
α-helix	110-117	8
β-strand	131-140	10	20
β-strand	145-155	11	20
α-helix	161-173	13
α-helix	174-178	5
α-helix	181-182	2
α-helix	201-203	3
α-helix	209-213	5
α-helix	215-218	4
β-strand	223-225	3	22
α-helix	226-229	4
α-helix	233-236	4
α-helix	242-245	4
α-helix	259-277	19
β-strand	280-281	2	22
β-strand	290-293	4	22
α-helix	301-304	4
α-helix	308-310	3
α-helix	328-330	3
α-helix	351-353	3

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	23
α-helix	12-16	5
β-strand	25-26	2	23
β-strand	29-36	8	23
β-strand	41-47	7	23
β-strand	52-58	7	23
β-strand	72-79	8	23
β-strand	88-95	8	23
α-helix	102-117	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit CTC1	A, B	protein	1233	Homo sapiens	Q2NKJ3 (AlphaFold model)
DNA (5'-d(ptpapgpg)-3')	E	DNA	4	Homo sapiens
CST complex subunit STN1	C	protein	374	Homo sapiens	Q9H668 (AlphaFold model)
CST complex subunit TEN1	D	protein	152	Homo sapiens	Q86WV5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6W6W_1 CST complex subunit CTC1 (chains A, B)
MDYKDDDDKDYKDDDDKAAGRAQVPSSEQAWLEDAQVFIQKTLCPAVKEPNVQLTPLVID
CVKTVWLSQGRNQGSTLPLSYSFVSVQDLKTHQRLPCCSHLSWSSSAYQAWAQEAGPNGN
PLPREQLLLLGTLTDLSADLEQECRNGSLYVRDNTGVLSCELIDLDLSWLGHLFLFPRWS
YLPPARWNSSGEGHLELWDAPVPVFPLTISPGPVTPIPVLYPESASCLLRLRNKLRGVQR
NLAGSLVRLSALVKSKQKAYFILSLGRSHPAVTHVSIIVQVPAQLVWHRALRPGTAYVLT
ELRVSKIRGQRQHVWMTSQSSRLLLLKPECVQELELELEGPLLEADPKPLPMPSNSEDKK
DPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQ
DVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGL
PLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNA
HNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWASFDPKALLPLPEASYLPSC
QLNRRLAWSWLCLLPSAFCPAQVLLGVLVASSHKGCLQLRDQSGSLPCLLLAKHSQPLSD
PRLIGCLVRAERFQLIVERDVRSSFPSWKELSMPGFIQKQQARVYVQFFLADALILPVPR
PCLHSATPSTPQTDPTGPEGPHLGQSRLFLLCHKEALMKRNFCVPPGASPEVPKPALSFY
VLGSWLGGTQRKEGTGWGLPEPQGNDDNDQKVHLIFFGSSVRWFEFLHPGQVYRLIAPGP
ATPMLFEKDGSSCISRRPLELAGCASCLTVQDNWTLELESSQDIQDVLDANKSLPESSLT
DLLSDNFTDSLVSFSAEILSRTLCEPLVASLWMKLGNTGAMRRCVKLTVALETAECEFPP
HLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYCCFRSSTYVQVLSFPPETTIS
IPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCAYCTSICRQGKCTRLGSTCPT
QTAISQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREWASLLDFVQVPGRVVLQFAGP
GAQLESSARVDEPMTMFLWTLCTSPSVLRPIVLSFELERKPSKIVPLEPPRLQRFQCGEL
PFLTHVNPRLRLSCLSIRESEYSSSLGILASSC

Sequence of entity 2 (E), FASTA

>6W6W_2 DNA (5'-D(P*TP*AP*GP*G)-3') (chains E)
TAGG

Sequence of entity 3 (C), FASTA

>6W6W_3 CST complex subunit STN1 (chains C)
MHHHHHHQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPI
KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLK
KLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIY
RKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVES
LLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVT
REDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQ
SDIVSTMEHYYTAF

Sequence of entity 4 (D), FASTA

>6W6W_4 CST complex subunit TEN1 (chains D)
MSYYHHHHHHDYDIPTTENLYFQGAMGSGIQLPKPGTYYLPWEVSAGQVPDGSTLRTFGR
LCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKA
RVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

The structure of human CST reveals a decameric assembly bound to telomeric DNA. Lim, C.J., Barbour, A.T., Zaug, A.J. et al. Science (2020) 368:1081-1085. DOI 10.1126/science.aaz9649 · PubMed

Other PDB entries of the same protein (UniProt Q2NKJ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W2L 1.86 Å, Structure of a central domain of human Ctc1
8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
8SOK 4.1 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA
8D0K 4.27 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…

Browse structure collections

About this viewer

MolViewer shows 6W6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.