8D0K: CST complex subunit CTC1

Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback template - PRIM2C advanced PIC. Determined by electron microscopy at 4.27 Å resolution. Released 22 Jun 2022.

Method: Electron microscopy
Resolution: 4.27 Å
Organism: Homo sapiens
Chains: 8
Atoms: 31,011
Mol. weight: 568.8 kDa
Released: 22 Jun 2022

Explore 8D0K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D0K contains 173 α-helices and 190 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 76 β-strands

Element	Residues	Length	Sheet
α-helix	10-26	17
α-helix	38-52	15
β-strand	66-67	2	1
α-helix	70-76	7
β-strand	81-84	4	2
α-helix	89-98	10
α-helix	105-107	3
β-strand	108	1	2
β-strand	111-112	2	1
β-strand	114-118	5	3
β-strand	134-137	4	3
β-strand	140-143	4	3
β-strand	144-145	2	2
β-strand	157-159	3	3
β-strand	162-166	5	2
β-strand	178-180	3	2
α-helix	184-185	2
β-strand	186-187	2	3
α-helix	193-195	3
β-strand	201-202	2	4
β-strand	204	1	5
α-helix	206-214	9
α-helix	216-218	3
β-strand	224-233	10	5
β-strand	237	1	6
β-strand	244	1	6
β-strand	245-250	6	5
β-strand	259-263	5	5
α-helix	266-273	8
β-strand	280-288	9	5
β-strand	299-301	3	5
β-strand	307-309	3	5
β-strand	315-316	2	4
β-strand	351-352	2	7
β-strand	354-367	14	8
β-strand	372-375	4	8
β-strand	379-382	4	8
β-strand	400-409	10	8
β-strand	413	1	9
β-strand	416	1	9
β-strand	420-431	12	8
α-helix	437-439	3
α-helix	442-444	3
α-helix	450-454	5
α-helix	455-460	6
α-helix	464-481	18
α-helix	488-491	4
β-strand	496	1	10
β-strand	499	1	10
α-helix	502-514	13
α-helix	519-522	4
α-helix	524-529	6
β-strand	539-540	2	7
β-strand	548	1	11
α-helix	552-565	14
α-helix	569-572	4
α-helix	578-580	3
α-helix	583-590	8
β-strand	592-597	6	12
α-helix	599-601	3
β-strand	606	1	11
β-strand	608-614	7	13
β-strand	621-624	4	13
β-strand	631	1	13
β-strand	633-635	3	12
β-strand	641	1	12
β-strand	651-654	4	13
β-strand	658-667	10	12
α-helix	673-675	3
β-strand	681-693	13	12
β-strand	698-700	3	13
β-strand	729-738	10	14
α-helix	739-741	3
β-strand	742-744	3	15
β-strand	746	1	16
α-helix	748-749	2
α-helix	756-758	3
β-strand	760-762	3	15
β-strand	763-769	7	14
β-strand	774-775	2	14
β-strand	776-777	2	17
β-strand	780-781	2	17
α-helix	783-788	6
β-strand	795-800	6	14
α-helix	802-810	9
β-strand	816-821	6	14
β-strand	842	1	16
β-strand	859-862	4	14
α-helix	869-872	4
α-helix	878-879	2
α-helix	883-887	5
β-strand	896-908	13	18
β-strand	928-934	7	18
α-helix	943-944	2
β-strand	945-951	7	18
α-helix	956-958	3
β-strand	966-976	11	18
β-strand	982-985	4	18
β-strand	991-994	4	18
α-helix	997-999	3
α-helix	1006-1008	3
β-strand	1009	1	19
α-helix	1014-1016	3
β-strand	1024-1043	20	19
α-helix	1048	1
β-strand	1049	1	19
β-strand	1050-1051	2	20
β-strand	1054-1055	2	20
β-strand	1067-1078	12	19
β-strand	1084-1089	6	19
α-helix	1091-1096	6
α-helix	1101-1111	11
β-strand	1117-1119	3	19
α-helix	1137-1146	10
β-strand	1154-1161	8	19
β-strand	1175-1177	3	21
β-strand	1188-1190	3	21
α-helix	1191-1193	3
β-strand	1194-1202	9	19

Chain B: 16 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	10-13	4
α-helix	14-19	6
β-strand	27-28	2	22
α-helix	31-36	6
β-strand	39	1	23
β-strand	47-49	3	23
β-strand	52-54	3	23
β-strand	57-68	12	22
β-strand	72	1	24
β-strand	73-78	6	22
β-strand	83-87	5	22
β-strand	89	1	24
α-helix	104-124	21
β-strand	131-136	6	22
β-strand	138-141	4	22
β-strand	144-148	5	22
β-strand	151-154	4	22
α-helix	162-173	12
α-helix	174-178	5
α-helix	201-218	18
β-strand	224-225	2	25
α-helix	226-230	5
α-helix	233-239	7
α-helix	242-246	5
α-helix	255-276	22
β-strand	280-282	3	25
β-strand	290-293	4	25
α-helix	294-296	3
α-helix	298-309	12
α-helix	311-313	3
β-strand	322-323	2	26
α-helix	324-334	11
α-helix	341-353	13
β-strand	358-361	4	26
β-strand	364-366	3	26

Chain C: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	27
α-helix	12-16	5
β-strand	25-36	12	27
β-strand	41-48	8	27
β-strand	51-58	8	27
β-strand	72-81	10	27
β-strand	87-95	9	27
α-helix	102-119	18
α-helix	120-122	3

Chain D: 27 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	23-31	9
α-helix	32-34	3
α-helix	40-42	3
β-strand	43-45	3	28
β-strand	48-49	2	29
β-strand	53-54	2	29
α-helix	63-73	11
β-strand	79-84	6	28
α-helix	88-93	6
β-strand	101-103	3	28
β-strand	106-111	6	30
α-helix	112-115	4
α-helix	129-131	3
α-helix	132-145	14
α-helix	146-150	5
β-strand	157-159	3	30
β-strand	164-169	6	30
α-helix	179-189	11
α-helix	210-223	14
α-helix	224-231	8
α-helix	237-243	7
α-helix	244-246	3
α-helix	249-251	3
α-helix	252-261	10
α-helix	265-281	17
α-helix	292-301	10
α-helix	307-311	5
β-strand	317-318	2	28
α-helix	319	1
β-strand	323	1	31
β-strand	329	1	32
β-strand	330	1	31
α-helix	331	1
β-strand	333	1	30
α-helix	339-341	3
α-helix	344-346	3
β-strand	349	1	32
α-helix	350-367	18
α-helix	375-385	11
α-helix	389-417	29

Chain E: 28 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
β-strand	36-37	2	33
α-helix	39-62	24
α-helix	69-80	12
α-helix	93-109	17
α-helix	114-133	20
α-helix	137-146	10
β-strand	153	1	34
α-helix	156-161	6
α-helix	163-168	6
β-strand	184-187	4	34
α-helix	188-190	3
α-helix	192-196	5
β-strand	201-202	2	34
β-strand	206-209	4	34
α-helix	212-234	23
α-helix	238-240	3
α-helix	247-253	7
α-helix	268-270	3
α-helix	276-283	8
α-helix	286-298	13
α-helix	303-315	13
α-helix	320-332	13
α-helix	338-340	3
α-helix	341-345	5
α-helix	346-352	7
α-helix	363-366	4
α-helix	367-371	5
α-helix	374-376	3
α-helix	391-400	10
α-helix	405-416	12
α-helix	420-432	13
α-helix	444-454	11

Chain F: 40 helices, 42 β-strands

Element	Residues	Length	Sheet
β-strand	332-333	2	35
β-strand	339-340	2	35
β-strand	341-350	10	36
β-strand	359-367	9	36
β-strand	372-380	9	36
α-helix	383	1
β-strand	384-391	8	37
α-helix	410-416	7
α-helix	417-421	5
α-helix	422-425	4
β-strand	431-438	8	37
β-strand	449-458	10	37
α-helix	462-465	4
β-strand	473-477	5	37
α-helix	483-489	7
β-strand	498-501	4	36
β-strand	505	1	36
β-strand	512	1	38
β-strand	516-520	5	36
β-strand	526-529	4	36
α-helix	533-536	4
β-strand	537-548	12	39
β-strand	555-568	14	39
β-strand	581-586	6	39
α-helix	594-595	2
α-helix	598-605	8
β-strand	609-611	3	39
α-helix	615-629	15
β-strand	633-636	4	39
α-helix	639-643	5
α-helix	644-654	11
α-helix	659-662	4
β-strand	665	1	38
α-helix	679-684	6
β-strand	689-692	4	39
α-helix	693-700	8
α-helix	708-715	8
α-helix	725-731	7
α-helix	735-759	25
α-helix	761-772	12
α-helix	776-780	5
α-helix	784-797	14
β-strand	801	1	37
β-strand	844	1	40
β-strand	856-861	6	40
α-helix	864-872	9
α-helix	901-903	3
α-helix	907-908	2
α-helix	911-928	18
α-helix	936-961	26
α-helix	970-992	23
β-strand	998-1002	5	40
β-strand	1005-1009	5	40
α-helix	1015-1032	18
β-strand	1038-1044	7	40
β-strand	1048-1049	2	40
β-strand	1055-1062	8	40
β-strand	1068-1074	7	40
α-helix	1269-1272	4
α-helix	1277-1278	2
β-strand	1279-1282	4	41
β-strand	1289-1292	4	41
β-strand	1296-1297	2	42
α-helix	1300-1302	3
β-strand	1304-1305	2	42
α-helix	1319-1322	4
α-helix	1323-1341	19
β-strand	1346-1348	3	43
β-strand	1356-1357	2	43
β-strand	1364	1	44
β-strand	1369	1	44
β-strand	1370	1	45
α-helix	1371	1
β-strand	1378	1	45
β-strand	1379-1381	3	43
α-helix	1385-1397	13
α-helix	1401-1407	7
α-helix	1411-1420	10
α-helix	1424-1442	19
α-helix	1445-1447	3
β-strand	1449-1450	2	33
α-helix	1451-1454	4

Chain G: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	148-151	4
α-helix	159-162	4
β-strand	170-175	6	46
β-strand	194-196	3	47
α-helix	213-235	23
β-strand	247-259	13	48
β-strand	270-273	4	48
β-strand	283-287	5	48
β-strand	294-296	3	49
β-strand	300-308	9	48
β-strand	314-316	3	48
α-helix	324-326	3
β-strand	327	1	50
α-helix	328	1
α-helix	332-336	5
β-strand	339-345	7	46
α-helix	358-370	13
β-strand	374-378	5	46
α-helix	387-390	4
α-helix	398-416	19
β-strand	419-423	5	46
β-strand	435	1	51
β-strand	437	1	52
α-helix	438-440	3
α-helix	449-451	3
β-strand	453-455	3	46
α-helix	457	1
β-strand	458	1	52
β-strand	460-464	5	47
β-strand	467-471	5	47
α-helix	476-482	7
β-strand	485-487	3	49
α-helix	494-505	12
β-strand	520	1	51
α-helix	522-528	7
β-strand	534	1	50
β-strand	537-539	3	47
β-strand	547-551	5	47
β-strand	554-558	5	47
β-strand	563-564	2	53
β-strand	567-568	2	53
β-strand	570-577	8	46
α-helix	578-580	3
β-strand	592-597	6	46

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CST complex subunit CTC1	A	protein	1246	Homo sapiens	Q2NKJ3 (AlphaFold model)
CST complex subunit STN1	B	protein	374	Homo sapiens	Q9H668 (AlphaFold model)
CST complex subunit TEN1	C	protein	152	Homo sapiens	Q86WV5 (AlphaFold model)
DNA primase small subunit	D	protein	434	Homo sapiens	P49642 (AlphaFold model)
DNA primase large subunit	E	protein	523	Homo sapiens	P49643
DNA polymerase alpha catalytic subunit	F	protein	1527	Homo sapiens	P09884
DNA polymerase alpha subunit B	G	protein	612	Homo sapiens	Q14181
DNA (5'-d(ptpapgpgpgptptpapgpgpgptptpapgpgpgptptpa)-3')	H	DNA	60	Homo sapiens

Sequence of entity 1 (A), FASTA

>8D0K_1 CST complex subunit CTC1 (chains A)
MGDYKDHDGDYKDHDIDYKDDDDKSGGSLEAAGRAQVPSSEQAWLEDAQVFIQKTLCPAV
KEPNVQLTPLVIDCVKTVWLSQGRNQGSTLPLSYSFVSVQDLKTHQRLPCCSHLSWSSSA
YQAWAQEAGPNGNPLPREQLLLLGTLTDLSADLEQECRNGSLYVRDNTGVLSCELIDLDL
SWLGHLFLFPRWSYLPPARWNSSGEGHLELWDAPVPVFPLTISPGPVTPIPVLYPESASC
LLRLRNKLRGVQRNLAGSLVRLSALVKSKQKAYFILSLGRSHPAVTHVSIIVQVPAQLVW
HRALRPGTAYVLTELRVSKIRGQRQHVWMTSQSSRLLLLKPECVQELELELEGPLLEADP
KPLPMPSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGL
RRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGAS
LYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTL
DLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWASFDPKA
LLPLPEASYLPSCQLNRRLAWSWLCLLPSAFCPAQVLLGVLVASSHKGCLQLRDQSGSLP
CLLLAKHSQPLSDPRLIGCLVRAERFQLIVERDVRSSFPSWKELSMPGFIQKQQARVYVQ
FFLADALILPVPRPCLHSATPSTPQTDPTGPEGPHLGQSRLFLLCHKEALMKRNFCVPPG
ASPEVPKPALSFYVLGSWLGGTQRKEGTGWGLPEPQGNDDNDQKVHLIFFGSSVRWFEFL
HPGQVYRLVAPGPATPMLFEKDGSSCISRRPLELAGCASCLTVQDNWTLELESSQDIQDV
LDANKSLPESSLTDLLSDNFTDSLVSFSAEILSRTLCEPLVASLWMKLGNTGAMRRCVKL
TVALETAECEFPPHLDVYIEDPHLPPSLGLLPGARVHFSQLEKRVSRSHNVYCCFRSSTY
VQVLSFPPETTISVPLPHIYLAELLQGGQSPFQATASCHIVSVFSLQLFWVCAYCTSICR
QGKCTRLGSTCPTQTAISQAIIRLLVEDGTAEAVVTCRNHHVAAALGLCPREWASLLDFV
QVPGRVVLQFAGPGAQLESSARVDEPMTMFLWTLCTSPSVLRPIVLSFELERKPSKIVPL
EPPRLQRFQCGELPFLTHVNPRLRLSCLSIRESEYSSSLGILASSC

Sequence of entity 2 (B), FASTA

>8D0K_2 CST complex subunit STN1 (chains B)
MHHHHHHQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPI
KQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLK
KLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIY
RKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVES
LLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVT
REDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQ
SDIVSTMEHYYTAF

Sequence of entity 3 (C), FASTA

>8D0K_3 CST complex subunit TEN1 (chains C)
MSYYHHHHHHDYDIPTTENLYFQGAMGSGIQLPKPGTYYLPWEVSAGQVPDGSTLRTFGR
LCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKA
RVLTCVEGMNLPLLEQAIREQRLYKQERGGSQ

Sequence of entity 4 (D), FASTA

>8D0K_4 DNA primase small subunit (chains D)
MGHHHHHHGSGSGSGETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFS
FTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKEL
VFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVH
CWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEY
ALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKND
KYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFT
VPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSR
KGELLKKSDLQKDF

Sequence of entity 5 (E), FASTA

>8D0K_5 DNA primase large subunit (chains E)
MGHHHHHHGSGSGSGEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLA
IDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDHISHFIL
RLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEI
VASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKL
SKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLSTKSFPP
CMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYS
YNIRHSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPG
GISQILDLVKGTHYQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPI
QPETPQPKPSVQKTKDASSALASLNSSLEMDMEGLEDYFSEDS

Sequence of entity 6 (F), FASTA

>8D0K_6 DNA polymerase alpha catalytic subunit (chains F)
MGGSAGDYKDHDGDYKDHDIDYKDDDDKGASSAWSHPQFEKGGGSGGGSGGSAWSHPQFE
KGAGSAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTG
VYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKAR
NKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPP
PVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVE
STEEEQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSY
LGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQP
GVVFLFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEE
FDEKIATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHV
FGTNTSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPP
LVVMAFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPY
AFKEVIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKA
PHWSKIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQIL
KTERVVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIM
SRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKK
AAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQE
QIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSM
YGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLE
EVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKG
LDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEIN
KALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPE
QLQKQDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEE
NDALLGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCK
ASPLTFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMK
ATLQPEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNT
AEQFLSRSGYSEVNLSKLFAGCAVKSV

Sequence of entity 7 (G), FASTA

>8D0K_7 DNA polymerase alpha subunit B (chains G)
MGHHHHHHGSGSGSGSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELI
AFCTSTHKVGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEE
EILLNSYTTPSKGSQKRAISTPETPLTKRSVSTRSPHQLLSPSSFSPSATPSQKYNSRSN
RGEVVTSFGLAQGVSWSGRGGAGNISLKVLGCPEALTGSYKSMFQKLPDIREVLTCKIEE
LGSELKEHYKIEAFTPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPV
DLSELKEYSLFPGQVVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVAC
GPYTTSDSITYDPLLDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCL
RTIIEGTRSSGSHLVFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSING
VIFGLTSTDLLFHLGAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFY
VYAQLPVTPDVLIIPSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAER
QSPCIAVQVVRI

Sequence of entity 8 (H), FASTA

>8D0K_8 DNA (5'-D(P*TP*AP*GP*GP*GP*TP*TP*AP*GP*GP*GP*TP*TP*AP*GP*GP*GP*TP*TP*A)-3') (chains H)
CTAACCGCATCTAGCTTTTTGCTAGATGCGGTTAGCTTAGGGTTAGGGTTAGGGTTAGGG

Primary citation

Structures of the human CST-Pol alpha-primase complex bound to telomere templates. He, Q., Lin, X., Chavez, B.L. et al. Nature (2022) 608:826-832. DOI 10.1038/s41586-022-05040-1 · PubMed

Other PDB entries of the same protein (UniProt Q2NKJ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W2L 1.86 Å, Structure of a central domain of human Ctc1
6W6W 3.0 Å, Cryo-EM structure of CST bound to telomeric single-stranded DNA
8D0B 3.43 Å, Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback…
8SOJ 3.8 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the absence of telomeric ssDNA
8SOK 4.1 Å, Cryo-EM structure of human CST bound to POT1(ESDL)/TPP1 in the presence of telomeric ssDNA
7U5C 4.6 Å, Cryo-EM structure of human CST bound to DNA polymerase alpha-primase in a recruitment…

Browse structure collections

About this viewer

MolViewer shows 8D0K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.