Human open state TMEM175 in KCl. Determined by electron microscopy at 2.64 Å resolution. Released 15 Apr 2020.
Explore 6WC9 in 3D Show helices and sheets RCSB PDB PDBe
6WC9 contains 44 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 1 |
| α-helix | 34-48 | 15 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-56 | 4 | |
| α-helix | 67-101 | 35 | |
| β-strand | 102 | 1 | 2 |
| β-strand | 105 | 1 | 1 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 138-163 | 26 | |
| α-helix | 165-167 | 3 | |
| β-strand | 168 | 1 | 2 |
| α-helix | 170-172 | 3 | |
| α-helix | 255 | 1 | |
| β-strand | 256 | 1 | 3 |
| α-helix | 257 | 1 | |
| α-helix | 258-283 | 26 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-305 | 7 | |
| α-helix | 307-331 | 25 | |
| β-strand | 334 | 1 | 4 |
| β-strand | 337 | 1 | 3 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-398 | 30 | |
| β-strand | 405 | 1 | 4 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-438 | 23 | |
| α-helix | 444-460 | 17 | |
| α-helix | 462-507 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 5 |
| α-helix | 34-48 | 15 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-56 | 4 | |
| α-helix | 67-101 | 35 | |
| β-strand | 102 | 1 | 6 |
| β-strand | 105 | 1 | 5 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 138-163 | 26 | |
| α-helix | 165-167 | 3 | |
| β-strand | 168 | 1 | 6 |
| α-helix | 170-172 | 3 | |
| α-helix | 255 | 1 | |
| β-strand | 256 | 1 | 7 |
| α-helix | 257 | 1 | |
| α-helix | 258-283 | 26 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-305 | 7 | |
| α-helix | 307-331 | 25 | |
| β-strand | 334 | 1 | 8 |
| β-strand | 337 | 1 | 7 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-398 | 30 | |
| β-strand | 405 | 1 | 8 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-438 | 23 | |
| α-helix | 444-460 | 17 | |
| α-helix | 462-475 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endosomal/lysosomal potassium channel TMEM175 | A, B | protein | 504 | Homo sapiens | Q9BSA9 (AlphaFold model) |
>6WC9_1 Endosomal/lysosomal potassium channel TMEM175 (chains A, B) MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA RPEHPPPAPTGQDDPQSQLLPAPC
Gating and selectivity mechanisms for the lysosomal K + channel TMEM175. Oh, S., Paknejad, N., Hite, R.K. Elife (2020) 9. DOI 10.7554/eLife.53430 · PubMed
Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6WC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.