6WCJ: Asymmetric vertex of the clathrin minicoat cage
Asymmetric vertex of the clathrin minicoat cage. Determined by electron microscopy at 6.3 Å resolution. Released 19 Aug 2020.
- Method
- Electron microscopy
- Resolution
- 6.3 Å
- Organism
- Bos taurus
- Chains
- 15
- Atoms
- 41,184
- Mol. weight
- 1876.86 kDa
- Released
- 19 Aug 2020
Explore 6WCJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6WCJ contains 376 α-helices and 0 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 33 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1250-1262 | 13 | |
| α-helix | 1266-1272 | 7 | |
| α-helix | 1273-1275 | 3 | |
| α-helix | 1280-1293 | 14 | |
| α-helix | 1296-1306 | 11 | |
| α-helix | 1314-1327 | 14 | |
| α-helix | 1329-1339 | 11 | |
| α-helix | 1340-1342 | 3 | |
| α-helix | 1345-1354 | 10 | |
| α-helix | 1358-1367 | 10 | |
| α-helix | 1371-1380 | 10 | |
| α-helix | 1388-1394 | 7 | |
| α-helix | 1395-1397 | 3 | |
| α-helix | 1402-1413 | 12 | |
| α-helix | 1416-1418 | 3 | |
| α-helix | 1419-1426 | 8 | |
| α-helix | 1427-1429 | 3 | |
| α-helix | 1432-1442 | 11 | |
| α-helix | 1445-1455 | 11 | |
| α-helix | 1456-1458 | 3 | |
| α-helix | 1461-1473 | 13 | |
| α-helix | 1478-1486 | 9 | |
| α-helix | 1492-1499 | 8 | |
| α-helix | 1505-1516 | 12 | |
| α-helix | 1524-1528 | 5 | |
| α-helix | 1537-1543 | 7 | |
| α-helix | 1550-1559 | 10 | |
| α-helix | 1563-1565 | 3 | |
| α-helix | 1566-1572 | 7 | |
| α-helix | 1574-1576 | 3 | |
| α-helix | 1579-1587 | 9 | |
| α-helix | 1596-1634 | 39 | |
| α-helix | 1637-1640 | 4 | |
Chain B: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 100-159 | 60 | |
| α-helix | 189-198 | 10 | |
| α-helix | 202-206 | 5 | |
| α-helix | 211-223 | 13 | |
| α-helix | 224-226 | 3 | |
Chain C: 34 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1250-1262 | 13 | |
| α-helix | 1266-1272 | 7 | |
| α-helix | 1273-1275 | 3 | |
| α-helix | 1280-1293 | 14 | |
| α-helix | 1296-1306 | 11 | |
| α-helix | 1314-1327 | 14 | |
| α-helix | 1329-1339 | 11 | |
| α-helix | 1340-1342 | 3 | |
| α-helix | 1345-1354 | 10 | |
| α-helix | 1358-1367 | 10 | |
| α-helix | 1371-1380 | 10 | |
| α-helix | 1388-1394 | 7 | |
| α-helix | 1395-1397 | 3 | |
| α-helix | 1402-1413 | 12 | |
| α-helix | 1416-1418 | 3 | |
| α-helix | 1419-1426 | 8 | |
| α-helix | 1427-1429 | 3 | |
| α-helix | 1432-1442 | 11 | |
| α-helix | 1445-1455 | 11 | |
| α-helix | 1456-1458 | 3 | |
| α-helix | 1461-1473 | 13 | |
| α-helix | 1478-1486 | 9 | |
| α-helix | 1492-1499 | 8 | |
| α-helix | 1505-1517 | 13 | |
| α-helix | 1524-1528 | 5 | |
| α-helix | 1537-1544 | 8 | |
| α-helix | 1550-1559 | 10 | |
| α-helix | 1563-1565 | 3 | |
| α-helix | 1566-1572 | 7 | |
| α-helix | 1574-1576 | 3 | |
| α-helix | 1579-1584 | 6 | |
| α-helix | 1585-1589 | 5 | |
| α-helix | 1596-1634 | 39 | |
| α-helix | 1637-1640 | 4 | |
Chain D: 34 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1250-1262 | 13 | |
| α-helix | 1266-1272 | 7 | |
| α-helix | 1273-1275 | 3 | |
| α-helix | 1280-1293 | 14 | |
| α-helix | 1296-1306 | 11 | |
| α-helix | 1314-1324 | 11 | |
| α-helix | 1329-1339 | 11 | |
| α-helix | 1340-1342 | 3 | |
| α-helix | 1345-1354 | 10 | |
| α-helix | 1358-1367 | 10 | |
| α-helix | 1371-1380 | 10 | |
| α-helix | 1388-1394 | 7 | |
| α-helix | 1395-1397 | 3 | |
| α-helix | 1402-1413 | 12 | |
| α-helix | 1416-1418 | 3 | |
| α-helix | 1419-1426 | 8 | |
| α-helix | 1427-1429 | 3 | |
| α-helix | 1432-1442 | 11 | |
| α-helix | 1445-1455 | 11 | |
| α-helix | 1456-1458 | 3 | |
| α-helix | 1461-1473 | 13 | |
| α-helix | 1478-1486 | 9 | |
| α-helix | 1492-1499 | 8 | |
| α-helix | 1505-1517 | 13 | |
| α-helix | 1524-1528 | 5 | |
| α-helix | 1537-1543 | 7 | |
| α-helix | 1550-1559 | 10 | |
| α-helix | 1563-1565 | 3 | |
| α-helix | 1566-1572 | 7 | |
| α-helix | 1574-1576 | 3 | |
| α-helix | 1579-1584 | 6 | |
| α-helix | 1585-1589 | 5 | |
| α-helix | 1596-1634 | 39 | |
| α-helix | 1637-1640 | 4 | |
Chain E: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 100-160 | 61 | |
| α-helix | 189-198 | 10 | |
| α-helix | 202-206 | 5 | |
| α-helix | 211-223 | 13 | |
| α-helix | 224-226 | 3 | |
Chain F: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 100-160 | 61 | |
| α-helix | 189-197 | 9 | |
| α-helix | 202-206 | 5 | |
| α-helix | 211-223 | 13 | |
| α-helix | 224-226 | 3 | |
Chain G: 49 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 812-822 | 11 | |
| α-helix | 827-832 | 6 | |
| α-helix | 845-852 | 8 | |
| α-helix | 855-858 | 4 | |
| α-helix | 859-868 | 10 | |
| α-helix | 873-884 | 12 | |
| α-helix | 891-895 | 5 | |
| α-helix | 902-909 | 8 | |
| α-helix | 914-924 | 11 | |
| α-helix | 927-929 | 3 | |
| α-helix | 930-934 | 5 | |
| α-helix | 940-949 | 10 | |
| α-helix | 953-959 | 7 | |
| α-helix | 967-981 | 15 | |
| α-helix | 985-998 | 14 | |
| α-helix | 1006-1013 | 8 | |
| α-helix | 1026-1035 | 10 | |
| α-helix | 1039-1045 | 7 | |
| α-helix | 1052-1061 | 10 | |
| α-helix | 1066-1074 | 9 | |
| α-helix | 1078-1088 | 11 | |
| α-helix | 1092-1101 | 10 | |
| α-helix | 1105-1118 | 14 | |
| α-helix | 1121-1129 | 9 | |
| α-helix | 1137-1144 | 8 | |
| α-helix | 1153-1161 | 9 | |
| α-helix | 1168-1180 | 13 | |
| α-helix | 1183-1191 | 9 | |
| α-helix | 1201-1207 | 7 | |
| α-helix | 1214-1219 | 6 | |
| α-helix | 1227-1234 | 8 | |
| α-helix | 1238-1247 | 10 | |
| α-helix | 1250-1262 | 13 | |
| α-helix | 1267-1273 | 7 | |
| α-helix | 1281-1293 | 13 | |
| α-helix | 1296-1304 | 9 | |
| α-helix | 1314-1326 | 13 | |
| α-helix | 1332-1338 | 7 | |
| α-helix | 1345-1355 | 11 | |
| α-helix | 1358-1367 | 10 | |
| α-helix | 1371-1380 | 10 | |
| α-helix | 1388-1394 | 7 | |
| α-helix | 1395-1397 | 3 | |
| α-helix | 1403-1414 | 12 | |
| α-helix | 1418-1426 | 9 | |
| α-helix | 1432-1441 | 10 | |
| α-helix | 1446-1448 | 3 | |
| α-helix | 1449-1452 | 4 | |
| α-helix | 1461-1472 | 12 | |
Chain H: 35 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 639-642 | 4 | |
| α-helix | 648-656 | 9 | |
| α-helix | 663-672 | 10 | |
| α-helix | 681-684 | 4 | |
| α-helix | 686-688 | 3 | |
| α-helix | 696-703 | 8 | |
| α-helix | 710-715 | 6 | |
| α-helix | 725-734 | 10 | |
| α-helix | 741-743 | 3 | |
| α-helix | 744-750 | 7 | |
| α-helix | 756-765 | 10 | |
| α-helix | 774-780 | 7 | |
| α-helix | 784-794 | 11 | |
| α-helix | 799-802 | 4 | |
| α-helix | 803-807 | 5 | |
| α-helix | 809-811 | 3 | |
| α-helix | 812-821 | 10 | |
| α-helix | 826-832 | 7 | |
| α-helix | 843-851 | 9 | |
| α-helix | 855-857 | 3 | |
| α-helix | 859-868 | 10 | |
| α-helix | 873-885 | 13 | |
| α-helix | 892-896 | 5 | |
| α-helix | 902-908 | 7 | |
| α-helix | 914-924 | 11 | |
| α-helix | 927-937 | 11 | |
| α-helix | 941-947 | 7 | |
| α-helix | 953-959 | 7 | |
| α-helix | 967-981 | 15 | |
| α-helix | 985-997 | 13 | |
| α-helix | 1006-1013 | 8 | |
| α-helix | 1026-1035 | 10 | |
| α-helix | 1039-1046 | 8 | |
| α-helix | 1052-1061 | 10 | |
| α-helix | 1066-1074 | 9 | |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Clathrin heavy chain 1 | A, C, D, G, H, I, K, L, M | protein | 1675 | Bos taurus | P49951 (AlphaFold model) |
| Clathrin light chain B | B, E, F, J, N, O | protein | 228 | Bos taurus | P04975 (AlphaFold model) |
Sequence of entity 1 (A, C, D, G, H, I, K, L, M), FASTA
>6WCJ_1 Clathrin heavy chain 1 (chains A, C, D, G, H, I, K, L, M)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPAYGQPQPGFGYSM
Sequence of entity 2 (B, E, F, J, N, O), FASTA
>6WCJ_2 Clathrin light chain B (chains B, E, F, J, N, O)
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSQGGLAQPGPA
SGASEDMGATVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAAS
KVMEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFVK
ESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
Primary citation
The structures of natively assembled clathrin-coated vesicles. Paraan, M., Mendez, J., Sharum, S. et al. Sci Adv (2020) 6:eaba8397-eaba8397. DOI 10.1126/sciadv.aba8397 · PubMed
Other PDB entries of the same protein (UniProt P49951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5M5T 1.7 Å, Clathrin heavy chain N-terminal domain bound to a non-natural clathrin-box motif peptide…
- 9F8T 1.71 Å, Clathrin terminal domain complexed with C-terminus of AAK1L
- 5M5R 1.76 Å, Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif
- 5M61 1.84 Å, Clathrin heavy chain N-terminal domain bound to an extended amphiphysin clathrin-box motif
- 5M5S 1.88 Å, Clathrin heavy chain N-terminal domain bound to amphiphysin clathrin-box motif
- 5M5V 1.96 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
- 5M5U 2.15 Å, Clathrin heavy chain N-terminal domain bound to a clathrin-box motif from hepatitis D…
- 3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
- 1UTC 2.3 Å, Clathrin terminal domain complexed with TLPWDLWTT
- 1B89 2.6 Å, Clathrin heavy chain proximal leg segment (BOVINE)
- 3GD1 3.5 Å, Structure of an Arrestin/Clathrin complex reveals a novel clathrin binding domain that…
- 3QIL 3.92 Å, Crystal structure analysis of the clathrin trimerization domain
Browse structure collections
About this viewer
MolViewer shows 6WCJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.