6WFW: Fab364

Crystal structure of Fab364 in complex with NPNA2 peptide from circumsporozoite protein. Determined by X-ray diffraction at 2.09 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 2.09 Å
Organisms: Streptococcus sp. group G, Homo sapiens, Plasmodium falciparum
Chains: 4
Atoms: 3,767
Mol. weight: 54.17 kDa
Released: 29 Jul 2020

Explore 6WFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WFW contains 17 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
β-strand	17-25	9	1
α-helix	28-41	14
β-strand	46-51	6	1
β-strand	56-61	6	1

Chain H: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	11-12	2	3
β-strand	17-25	9	2
α-helix	29-31	3
β-strand	34-39	6	4
β-strand	45-51	7	4
β-strand	57-59	3	4
β-strand	67-72	6	2
β-strand	77-82A	7	2
α-helix	84-86	3
β-strand	88-95	8	4
α-helix	96	1
β-strand	100B-103	4	4
β-strand	107-109	3	4
β-strand	110-111	2	3
β-strand	116	1	5
α-helix	117-118	2
β-strand	119-123	5	6
β-strand	134-144	11	6
β-strand	145	1	5
β-strand	150-153	4	1
α-helix	154-156	3
β-strand	158	1	1
β-strand	162-164	3	6
α-helix	165-167	3
β-strand	168-169	2	6
β-strand	175-184	10	6
α-helix	185-189	5
β-strand	194-199	6	1
α-helix	200-202	3
β-strand	204-209	6	1

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	33-38	6	8
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	85-90	6	8
β-strand	97-98	2	8
β-strand	102-106	5	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	145-150	6	11
β-strand	153-154	2	11
α-helix	155	1
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-187	5
β-strand	191-197	7	11
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein G	G	protein	60	Streptococcus sp. group G	P19909 (AlphaFold model)
Fab364 heavy chain	H	protein	219	Homo sapiens
Fab364 light chain	L	protein	211	Homo sapiens
NPNA2 peptide	P	protein	8	Plasmodium falciparum	P02893 (AlphaFold model)

Sequence of entity 1 (G), FASTA

>6WFW_1 Immunoglobulin G-binding protein G (chains G)
PAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEH

Sequence of entity 2 (H), FASTA

>6WFW_2 Fab364 heavy chain (chains H)
QVQLVESGGGVVQPXGSLRLSCAASGFTFSGYGMHWVRQVPGKGLEWVAIIWFDGSQKYY
ADSVQGRFTISRDNXKKTLFLRMNSLRAEDTAVYYCAKVHDDEPTQDYWGQGTLVTVFNQ
IKGPSVFPLAPSXXXXXSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK

Sequence of entity 3 (L), FASTA

>6WFW_3 Fab364 light chain (chains L)
IQMTQSPSTLSASVGDRVTITCRASQGISTSLAWYQQKPGKAPKLLIYKASSLESGVPSR
FSGSGSGTEFTLTITSLQPEDFATYYCQQYKRYWTFGQGTKVEIKRTVAAPSVFIFPPSD
EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLS
KADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Sequence of entity 4 (P), FASTA

>6WFW_4 NPNA2 peptide (chains P)
NPNANPNA

Primary citation

Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum. Pholcharee, T., Oyen, D., Flores-Garcia, Y. et al. Nat Commun (2021) 12:1063-1063. DOI 10.1038/s41467-021-21221-4 · PubMed

Other PDB entries of the same protein (UniProt P19909 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FIL 0.88 Å, Structural and energetic determinants for hyperstable variants of GB1 obtained from…
2QMT 1.05 Å, Crystal Polymorphism of Protein GB1 Examined by Solid-state NMR and X-ray Diffraction
9I2I 1.08 Å, X-ray structure of the B1 domain of streptococcal protein G triple mutant T2Q, N8D, and…
6CHE 1.1 Å, Selenomethionine mutant (A34Sem) of protein GB1 examined by X-ray diffraction
6CPZ 1.12 Å, Selenomethionine mutant (I6Sem) of protein GB1 examined by X-ray diffraction
2GI9 1.14 Å, Backbone Conformational Constraints in a Microcrystalline U-15N-Labeled Protein by 3D…
6C9O 1.2 Å, Selenomethionine mutant (V29Sem) of protein GB1 examined by X-ray diffraction
6CTE 1.2 Å, 77Se-NMR probes the protein environment of selenomethionine
6OC7 1.3 Å, HMP42 Fab in complex with Protein G
6NLA 1.34 Å, Crystal structure of de novo designed metal-controlled dimer of B1…
2ON8 1.35 Å, Gbeta1 stabilization by in vitro evolution and computational design
12LO 1.37 Å, X-ray crystal structure of Protein GB1 mutant K13A

Browse structure collections

About this viewer

MolViewer shows 6WFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.