6WIZ: Fab 54-1G05

Crystal structure of Fab 54-1G05 bound to H1 influenza hemagglutinin. Determined by X-ray diffraction at 4.2 Å resolution. Released 1 Jul 2020.

Method: X-ray diffraction
Resolution: 4.2 Å
Organisms: Influenza A virus, Homo sapiens
Chains: 4
Atoms: 7,442
Mol. weight: 104.97 kDa
Ligands: NAG
Released: 1 Jul 2020

Explore 6WIZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WIZ contains 28 α-helices and 100 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
β-strand	16-17	2	1
β-strand	18	1	2
β-strand	25-26	2	3
β-strand	34-35	2	3
β-strand	36	1	4
β-strand	39-41	3	5
β-strand	43-44	2	6
β-strand	51-54	4	7
α-helix	57-58	2
β-strand	59-60	2	8
β-strand	64	1	9
α-helix	66-71	6
β-strand	84	1	10
β-strand	87-89	3	8
β-strand	95	1	9
α-helix	101	1
β-strand	102	1	10
α-helix	106-109	4
β-strand	115-122	8	10
β-strand	130-131	2	11
β-strand	136-140	5	12
β-strand	145-146	2	12
β-strand	151-153	3	10
β-strand	155-156	2	11
β-strand	157	1	13
β-strand	160	1	13
β-strand	164-169	6	14
β-strand	175-184	10	10
α-helix	188-194	7
β-strand	202-206	5	14
β-strand	209-212	4	14
β-strand	229-237	9	10
β-strand	242-247	6	14
β-strand	251-254	4	10
β-strand	256-262	7	10
β-strand	267-269	3	8
α-helix	272-273	2
β-strand	274-279	6	7
β-strand	282	1	15
β-strand	287	1	15
β-strand	294-295	2	6
β-strand	302-303	2	16
α-helix	306-307	2
β-strand	308	1	6
β-strand	315-317	3	5
β-strand	321	1	4

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	17
β-strand	10	1	17
β-strand	14	1	2
β-strand	22-28	7	1
β-strand	31-36	6	1
α-helix	38-56	19
β-strand	64-65	2	16
α-helix	75-126	52
β-strand	130-132	3	1
β-strand	137-140	4	1
α-helix	146-154	9
α-helix	164-172	9

Chain H: 6 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	18
β-strand	10-12	3	19
β-strand	17-25	9	18
β-strand	34-40	7	19
β-strand	44-52A	10	19
β-strand	55-59	5	19
β-strand	67-68	2	18
β-strand	71-72	2	18
β-strand	77-82A	7	18
α-helix	84-86	3
β-strand	88-92	5	19
β-strand	94	1	20
β-strand	98-100	3	21
β-strand	100B-100C	2	21
β-strand	102	1	20
β-strand	104	1	18
β-strand	108-111	4	19
β-strand	117	1	22
β-strand	120-124	5	23
α-helix	125-127	3
β-strand	136-145	10	23
β-strand	146	1	22
β-strand	151-154	4	24
α-helix	155-157	3
β-strand	163-165	3	23
α-helix	166-168	3
β-strand	169-170	2	23
β-strand	176-184	9	23
α-helix	186-188	3
β-strand	194-200	7	24
α-helix	201-203	3
β-strand	205-211	7	24

Chain L: 11 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	25
β-strand	10-13	4	26
α-helix	18	1
β-strand	19-25	7	25
α-helix	28-30	3
β-strand	33-38	6	26
α-helix	43-44	2
β-strand	46-49	4	26
β-strand	53-54	2	26
α-helix	55	1
β-strand	62	1	25
β-strand	65-67	3	25
β-strand	70-75	6	25
α-helix	80-82	3
β-strand	85-90	6	26
β-strand	92-93	2	27
β-strand	95A-95B	2	27
β-strand	98	1	26
β-strand	102-106	5	26
α-helix	107	1
β-strand	111	1	28
α-helix	112-115	4
β-strand	116-118	3	29
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-135	7	29
β-strand	139	1	30
β-strand	140	1	28
β-strand	145-150	6	31
β-strand	153-154	2	31
β-strand	159-163	5	29
α-helix	164-167	4
β-strand	173	1	30
β-strand	175-182	8	29
α-helix	183-187	5
β-strand	191-197	7	31
β-strand	205-210	6	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin HA1	A	protein	327	Influenza A virus	A7Y8I1
Hemagglutinin HA2	B	protein	174	Influenza A virus	A7UPX0
Fab 54-1G05 heavy chain	H	protein	230	Homo sapiens
Fab 54-1G05 light chain	L	protein	217	Homo sapiens

Sequence of entity 1 (A), FASTA

>6WIZ_1 Hemagglutinin HA1 (chains A)
GDTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPLQLGNCSVAG
WILGNPECELLISRESWSYIVEKPNPENGTCYPGHFADYEELREQLSSVSSFERFEIFPK
ESSWPNHTTTGVSASCSHNGESSFYKNLLWLTGKNGLYPNLSKSYANNKEKEVLVLWGVH
HPPNIGDQRALYHKENAYVSVVSSHYSRKFTPEIAKRPKVRDQEGRINYYWTLLEPGDTI
IFEANGNLIAPRYAFALSRGFGSGIINSNAPMDECDAKCQTPQGAINSSLPFQNVHPVTI
GECPKYVRSAKLRMVTGLRNIPSIQSR

Sequence of entity 2 (B), FASTA

>6WIZ_2 Hemagglutinin HA2 (chains B)
GLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMN
TQFTAVGKEFNKLERRMENLNKKVDDGFIDIWTYNAELLVLLENERTLDFHDSNVKNLYE
KVKSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEESKLNREKID

Sequence of entity 3 (H), FASTA

>6WIZ_3 Fab 54-1G05 heavy chain (chains H)
QVQLQQSGPRLVKPSQTLSLTCAISGDSVSSSSAVWTWIRQSPSRGLEWLGRTYYRSKWY
DDYAVSVQGRITINPDTSKNQISLQLNSVTPDDTAVYYCARSSINIFGVFVMAMDVWGQG
TAVTVSSPSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Sequence of entity 4 (L), FASTA

>6WIZ_4 Fab 54-1G05 light chain (chains L)
EIVLTQSPGTLSLSPGERVTLSCRASQTVYNSYLAWYQQKPGQAPTLLIYGTSTRATGVP
DRFSGSGSGTVFTLTISRLEPEDFAVYFCQQYSTSPRALTFGGGTKVEIKRTVAAPSVFI
FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS
TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Convergent Evolution in Breadth of Two VH6-1-Encoded Influenza Antibody Clonotypes from a Single Donor. Wu, N.C., Andrews, S.F., Raab, J.E. et al. Cell Host Microbe (2020) 28:434. DOI 10.1016/j.chom.2020.06.003 · PubMed

Other PDB entries of the same protein (UniProt A7Y8I1), best resolution first:

6CF7 2.72 Å, Crystal structure of the A/Solomon Islands/3/2006(H1N1) influenza virus hemagglutinin in…
6FYT 2.8 Å, Structure of H1 (A/solomon Islands/3/06) Influenza Hemagglutinin in complex with SD38
5UGY 2.8 Å, Influenza hemagglutinin in complex with a neutralizing antibody
9CU7 2.82 Å, Structure of 16.ND.92 Fab in complex with A/Solomon Islands/3/2006(H1N1) influenza virus…
6OC3 2.85 Å, Crystal structure of FluA-20 Fab in complex with the head domain of H1 (A/Solomon…
9DBX 2.9 Å, Structure of AG11-2F01 Fab in complex with A/Solomon Islands/3/2006 (H1N1) influenza…
7UMM 3.36 Å, H1 Solomon Islands 2006 hemagglutinin in complex with Ab109
8U44 3.41 Å, CryoEM structure of A/Solomon Islands/3/2006 H1 HA in complex with 05.GC.w2.3C10-H1_SI06
7UMN 3.6 Å, H1 Solomon Islands 2006 hemagglutinin in complex with Ab36
6XSK 3.85 Å, Cryo-EM Structure of Vaccine-Elicited Rhesus Antibody 789-203-3C12 in Complex with…

Browse structure collections

About this viewer

MolViewer shows 6WIZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.