6WX8: SOX2

SOX2 bound to Importin-alpha 3. Determined by X-ray diffraction at 2.3 Å resolution. Released 28 Oct 2020.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,113
Mol. weight: 123.22 kDa
Released: 28 Oct 2020

Explore 6WX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WX8 contains 75 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-100	16
α-helix	107-112	6
α-helix	116-122	7
α-helix	129-143	15
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-198	10
α-helix	201-206	6
α-helix	214-227	14
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-324	9
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-377	8
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-464	7
α-helix	465-467	3
α-helix	471-484	14

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	47-62	16
α-helix	68-79	12
α-helix	84-103	20
α-helix	108-110	3
α-helix	112-113	2

Chain C: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	71-80	10
α-helix	85-100	16
α-helix	107-112	6
α-helix	116-123	8
α-helix	129-143	15
α-helix	147-155	9
α-helix	159-165	7
α-helix	171-185	15
α-helix	189-198	10
α-helix	201-206	6
α-helix	214-227	14
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-311	14
α-helix	316-324	9
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-398	17
α-helix	401-409	9
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-441	17
α-helix	446-455	10
α-helix	458-464	7
α-helix	465-467	3
α-helix	471-484	14

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	47-62	16
α-helix	68-79	12
α-helix	84-103	20
α-helix	111-113	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A, C	protein	459	Homo sapiens	O00629 (AlphaFold model)
Transcription factor SOX-2	B, D	protein	90	Homo sapiens	P48431 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6WX8_1 Importin subunit alpha-3 (chains A, C)
SGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHC
LERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALG
NIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQE
ILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQT
AALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQ
AVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTV
KDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIID
QFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B, D), FASTA

>6WX8_2 Transcription factor SOX-2 (chains B, D)
SDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRL
RALHMKEHPDYKYRPRRKTKTLMKKDKYTL

Primary citation

Structural basis for nuclear import selectivity of pioneer transcription factor SOX2. Jagga, B., Edwards, M., Pagin, M. et al. Nat Commun (2021) 12:28-28. DOI 10.1038/s41467-020-20194-0 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 6WX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.