6WZW: Ash1L SET domain

Ash1L SET domain in complex with AS-85. Determined by X-ray diffraction at 1.69 Å resolution. Released 7 Apr 2021.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,128
Mol. weight: 27.43 kDa
Ligands: UG7, ZN, SAM
Released: 7 Apr 2021

Explore 6WZW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WZW contains 12 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	2064-2065	2
β-strand	2070-2071	2	1
α-helix	2075	1
β-strand	2076-2077	2	2
β-strand	2083	1	3
β-strand	2103	1	4
α-helix	2111-2113	3
β-strand	2115	1	3
α-helix	2116-2118	3
α-helix	2125-2127	3
β-strand	2128	1	4
β-strand	2142-2146	5	5
β-strand	2152-2156	5	5
β-strand	2160	1	6
β-strand	2165-2168	4	3
β-strand	2172-2175	4	2
α-helix	2176-2185	10
α-helix	2187-2189	3
β-strand	2195-2199	5	2
β-strand	2202-2205	4	2
β-strand	2209-2210	2	1
α-helix	2212-2215	4
α-helix	2216	1
β-strand	2217-2218	2	7
β-strand	2224-2231	8	3
β-strand	2234-2241	8	3
β-strand	2245	1	6
α-helix	2249	1
β-strand	2250	1	5
α-helix	2251	1
β-strand	2252-2253	2	7
α-helix	2255-2258	4
β-strand	2259	1	2
β-strand	2267	1	8
β-strand	2278	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase ASH1L	A	protein	226	Homo sapiens	Q9NR48

Sequence of entity 1 (A), FASTA

>6WZW_1 Histone-lysine N-methyltransferase ASH1L (chains A)
GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTC
PCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNR
MIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYAL
KDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG

Ligands and cofactors

ID	Name	Formula	Copies
UG7	N-{[3-(3-carbamothioylphenyl)-1-{1-[(trifluoromethyl)sulfonyl]piperidin-4-yl}-1…	C26 H28 F3 N5 O3 S2	1
ZN	Zinc ion	Zn	3
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Water and common crystallization additives (EPE) are not listed.

Primary citation

Discovery of first-in-class inhibitors of ASH1L histone methyltransferase with anti-leukemic activity. Rogawski, D.S., Deng, J., Li, H. et al. Nat Commun (2021) 12:2792-2792. DOI 10.1038/s41467-021-23152-6 · PubMed

Other PDB entries of the same protein (UniProt Q9NR48), best resolution first:

8VLF 1.34 Å, Crystal structure of Ash1L PHD finger in complex with histone H3K4me3
6X0P 1.69 Å, Ash1L SET domain Q2265A mutant in complex with AS-5
8VLD 1.92 Å, Crystal structure of Ash1L PHD finger in complex with histone H3K4me2
4YNM 2.19 Å, ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM)
4YPE 2.2 Å, ASH1L SET domain H2193F mutant in complex with S-adenosyl methionine (SAM)
4YPA 2.3 Å, ASH1L SET domain Q2265A mutant in complex with S-adenosyl methionine (SAM)
8VLH 2.4 Å, Crystal structure of Ash1L PHD-BAH domains
3MQM 2.54 Å, Crystal Structure of the Bromodomain of human ASH1L
4YPU 2.6 Å, ASH1L SET domain K2264L mutant in complex with S-adenosyl methionine (SAM)
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
3OPE 2.9 Å, Structural Basis of Auto-inhibitory mechanism of Histone methyltransferase
4YNP 2.9 Å, ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM)

Browse structure collections

About this viewer

MolViewer shows 6WZW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.