6X3A: FN4-FN6 domains of human PTPRD

Crystal structure of the FN4-FN6 domains of human PTPRD. Determined by X-ray diffraction at 1.77 Å resolution. Released 26 May 2021.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,745
Mol. weight: 34.96 kDa
Released: 26 May 2021

Explore 6X3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6X3A contains 14 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	614-622	9	1
β-strand	625-631	7	1
α-helix	632-634	3
α-helix	635-637	3
β-strand	644-652	9	2
β-strand	660-666	7	2
β-strand	671-674	4	1
α-helix	677-678	2
β-strand	682-690	9	2
β-strand	695-698	4	2
α-helix	699-701	3
β-strand	702-705	4	2
α-helix	706-708	3
α-helix	714-715	2
β-strand	716-724	9	3
β-strand	727-733	7	3
α-helix	734-736	3
α-helix	737-739	3
β-strand	746-753	8	4
β-strand	754-755	2	5
β-strand	758-759	2	5
β-strand	764-769	6	4
α-helix	772-774	3
β-strand	783-787	5	3
α-helix	790-791	2
β-strand	795-804	10	4
β-strand	807-811	5	4
α-helix	812-814	3
β-strand	815-818	4	4
α-helix	819-824	6
β-strand	828-834	7	6
β-strand	838-844	7	6
β-strand	855-862	8	7
α-helix	868	1
β-strand	869-874	6	7
β-strand	879-883	5	6
β-strand	890-898	9	7
β-strand	903	1	7
α-helix	905-906	2
β-strand	907-912	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-type tyrosine-protein phosphatase delta	A	protein	314	Homo sapiens	P23468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6X3A_1 Receptor-type tyrosine-protein phosphatase delta (chains A)
PSTGSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPHEI
LGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEVEA
VNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDTTE
HDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTALIQ
WHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNKVG
FGEEMVKEISIPEE

Primary citation

Complex protein interactions mediate Drosophila Lar function in muscle tissue. Kawakami, J., Brooks, D., Zalmai, R. et al. PLoS One (2022) 17:e0269037-e0269037. DOI 10.1371/journal.pone.0269037 · PubMed

Other PDB entries of the same protein (UniProt P23468 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YD6 1.35 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
2YD7 1.98 Å, Crystal structure of the N-terminal Ig1-2 module of Human Receptor Protein Tyrosine…
4RCA 2.99 Å, Crystal structure of human PTPdelta and human Slitrk1 complex
5WY8 3.07 Å, Crystal structure of PTP delta Ig1-Ig3 in complex with IL1RAPL1 Ig1-Ig3
5XNP 3.73 Å, Crystal structures of human SALM5 in complex with human PTPdelta
1X5Z Solution structure of the fibronectin type-III domain of human protein tyrosine…
2DLH Solution structure of the second fn3 domain of human receptor-type tyrosine-protein…

Browse structure collections

About this viewer

MolViewer shows 6X3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.