Crystal structure of U2AF65 bound to AdML splice site sequence. Determined by X-ray diffraction at 1.5 Å resolution. Released 7 Oct 2020.
Explore 6XLW in 3D Show helices and sheets RCSB PDB PDBe
6XLW contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-149 | 4 | |
| β-strand | 150-154 | 5 | 1 |
| α-helix | 156-157 | 2 | |
| α-helix | 162-175 | 14 | |
| β-strand | 186-192 | 7 | 1 |
| β-strand | 197-202 | 6 | 1 |
| α-helix | 205-211 | 7 | |
| α-helix | 212-214 | 3 | |
| β-strand | 218-219 | 2 | 2 |
| β-strand | 222-223 | 2 | 2 |
| β-strand | 225-227 | 3 | 1 |
| α-helix | 234-235 | 2 | |
| β-strand | 251 | 1 | 3 |
| β-strand | 261-264 | 4 | 3 |
| α-helix | 272-280 | 9 | |
| β-strand | 285-292 | 8 | 3 |
| β-strand | 299-307 | 9 | 3 |
| α-helix | 312-320 | 9 | |
| β-strand | 324-325 | 2 | 4 |
| β-strand | 328-329 | 2 | 4 |
| β-strand | 331-334 | 4 | 3 |
| α-helix | 335-338 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Splicing factor U2AF 65 kDa subunit | A | protein | 204 | Homo sapiens | P26368 (AlphaFold model) |
| Dna/rna (5'-r(p*up*up*(ud)p*up*u)-d(p*(bru))-r(p*cp*c)-3') | B | RNA | 8 | synthetic construct |
>6XLW_1 Splicing factor U2AF 65 kDa subunit (chains A) GPLGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNF AFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDS AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAI AGLNGMQLGDKKLLVQRASVGAKN
>6XLW_2 DNA/RNA (5'-R(P*UP*UP*(UD)P*UP*U)-D(P*(BRU))-R(P*CP*C)-3') (chains B) UUUUUUCC
Representative cancer-associated U2AF2 mutations alter RNA interactions and splicing. Maji, D., Glasser, E., Henderson, S. et al. J Biol Chem (2020) 295:17148-17157. DOI 10.1074/jbc.RA120.015339 · PubMed
Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6XLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.