14-3-3 Sigma in complex with phosphorylated camkk2{pS511} peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 14 Oct 2020.
Explore 6Y8A in 3D Show helices and sheets RCSB PDB PDBe
6Y8A contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-30 | 12 | |
| α-helix | 34-37 | 4 | |
| α-helix | 38-69 | 32 | |
| α-helix | 74-76 | 3 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 253 | Homo sapiens | P31947 (AlphaFold model) |
| Calcium/calmodulin-dependent protein kinase kinase 2 | P | protein | 8 | Homo sapiens | Q96RR4 (AlphaFold model) |
>6Y8A_1 14-3-3 protein sigma (chains A) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNA GEEGGEAPQEPQS
>6Y8A_2 Calcium/calmodulin-dependent protein kinase kinase 2 (chains P) RSLSAPGN
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 3 |
Water and common crystallization additives (CL) are not listed.
A new soaking procedure for X-ray crystallographic structural determination of protein-peptide complexes. Ballone, A., Lau, R.A., Zweipfenning, F.P.A. et al. Acta Crystallogr F Struct Biol Commun (2020) 76:501-507. DOI 10.1107/S2053230X2001122X · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Y8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.