FKBP12 in complex with the BMP potentiator compound 6 at 1.03A resolution. Determined by X-ray diffraction at 1.03 Å resolution. Released 10 Mar 2021.
Explore 6YF2 in 3D Show helices and sheets RCSB PDB PDBe
6YF2 contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-8 | 7 | 1 |
| α-helix | 20-21 | 2 | |
| β-strand | 22-30 | 9 | 1 |
| β-strand | 35-38 | 4 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 46-48 | 3 | 1 |
| α-helix | 57-62 | 6 | |
| α-helix | 63-65 | 3 | |
| α-helix | 66-67 | 2 | |
| β-strand | 71-76 | 6 | 1 |
| α-helix | 78-80 | 3 | |
| β-strand | 87 | 1 | 2 |
| β-strand | 91 | 1 | 2 |
| β-strand | 97-106 | 10 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP1A | A | protein | 109 | Homo sapiens | P62942 (AlphaFold model) |
>6YF2_1 Peptidyl-prolyl cis-trans isomerase FKBP1A (chains A) GPGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRG WEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
| ID | Name | Formula | Copies |
|---|---|---|---|
| OP5 | (1~{R},9~{S},12~{S},13~{R},14~{S},17~{R},18~{E},21~{S},23~{S},24~{R},25~{S},27~… | C44 H69 N O13 | 1 |
| CD | Cadmium ion | Cd | 1 |
Water and common crystallization additives (CL, NA) are not listed.
Phenotypic screen identifies calcineurin-sparing FK506 analogs as BMP potentiators for treatment of acute kidney injury. Larraufie, M.H., Gao, X., Xia, X. et al. Cell Chem Biol (2021) 28:1271. DOI 10.1016/j.chembiol.2021.04.001 · PubMed
Other PDB entries of the same protein (UniProt P62942 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.