6YO8: 14-3-3 protein zeta/delta
Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide. Determined by X-ray diffraction at 2.09 Å resolution. Released 24 Mar 2021.
- Method
- X-ray diffraction
- Resolution
- 2.09 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 7,933
- Mol. weight
- 112.72 kDa
- Released
- 24 Mar 2021
Explore 6YO8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6YO8 contains 55 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-131 | 20 | |
| α-helix | 135-159 | 25 | |
| α-helix | 165-176 | 12 | |
| α-helix | 177-181 | 5 | |
| α-helix | 185-201 | 17 | |
| α-helix | 203-205 | 3 | |
| α-helix | 208-229 | 22 | |
Chain B: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 106-108 | 3 | |
| α-helix | 112-131 | 20 | |
| α-helix | 135-159 | 25 | |
| α-helix | 165-180 | 16 | |
| α-helix | 185-201 | 17 | |
| α-helix | 203-205 | 3 | |
| α-helix | 208-229 | 22 | |
Chain C: 12 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-15 | 11 | |
| α-helix | 19-30 | 12 | |
| α-helix | 34-36 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 78-100 | 23 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-131 | 20 | |
| α-helix | 138-159 | 22 | |
| α-helix | 165-180 | 16 | |
| α-helix | 185-201 | 17 | |
| α-helix | 203-205 | 3 | |
| α-helix | 208-229 | 22 | |
Chain D: 13 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 34-36 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 112-131 | 20 | |
| α-helix | 135-159 | 25 | |
| α-helix | 165-176 | 12 | |
| α-helix | 177-181 | 5 | |
| α-helix | 185-201 | 17 | |
| α-helix | 203-205 | 3 | |
| α-helix | 209-229 | 21 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 527-529 | 3 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 527-528 | 2 | |
Chains G and H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 521-523 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 14-3-3 protein zeta/delta | A, B, C, D | protein | 235 | Homo sapiens | P63104 (AlphaFold model) |
| Glucocorticoid receptor | E, F, G, H | protein | 13 | Homo sapiens | P04150 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>6YO8_1 14-3-3 protein zeta/delta (chains A, B, C, D)
GAMGSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGAR
RSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESK
VFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFS
VFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
Sequence of entity 2 (E, F, G, H), FASTA
>6YO8_2 Glucocorticoid receptor (chains E, F, G, H)
KTIVPATLPQLTP
Primary citation
Glucocorticoid receptor Thr524 phosphorylation by MINK1 induces interactions with 14-3-3 protein regulators. Munier, C.C., De Maria, L., Edman, K. et al. J Biol Chem (2021) 296:100551-100551. DOI 10.1016/j.jbc.2021.100551 · PubMed
Other PDB entries of the same protein (UniProt P63104 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2O02 1.5 Å, Phosphorylation independent interactions between 14-3-3 and Exoenzyme S: from structure…
- 6F09 1.59 Å, Binary complex of 14-3-3 zeta with ubiquitin specific protease 8 (USP8) pSer718 peptide
- 7ZIT 1.79 Å, 14-3-3 in complex with SARS-COV2 N phospho-peptide
- 9UJ2 1.8 Å, 14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213)
- 6ZFG 1.85 Å, 14-3-3 zeta chimera with 18E6 and fusicoccin
- 6F08 1.9 Å, 14-3-3 zeta in complex with the human Son of sevenless homolog 1 (SOS1)
- 6ZFD 1.9 Å, 14-3-3 zeta bound to the phosphorylated 18E6 C-terminus
- 4FJ3 1.95 Å, 14-3-3 isoform zeta in complex with a diphoyphorylated C-RAF peptide
- 5EXA 1.95 Å, Small-molecule stabilization of the 14-3-3/Gab2 PPI interface
- 8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
- 8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
- 1QJA 2.0 Å, 14-3-3 zeta/phosphopeptide complex (mode 2)
Browse structure collections
About this viewer
MolViewer shows 6YO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.