FOCAL ADHESION KINASE CATALYTIC DOMAIN IN COMPLEX WITH N-Methyl-N-(3-{[2-(2-oxo-2,3-dihydro-1H-indol-5-ylamino)-pyrimidin-4-ylamino]-methyl}-pyridin-2-yl)-methanesulfonamide. Determined by X-ray diffraction at 1.54 Å resolution. Released 10 Feb 2021.
Explore 6YT6 in 3D Show helices and sheets RCSB PDB PDBe
6YT6 contains 36 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 416 | 1 | 1 |
| α-helix | 417-418 | 2 | |
| α-helix | 419-421 | 3 | |
| β-strand | 422-430 | 9 | 1 |
| β-strand | 435-441 | 7 | 1 |
| β-strand | 449-455 | 7 | 1 |
| α-helix | 462-476 | 15 | |
| β-strand | 483 | 1 | 2 |
| α-helix | 484-485 | 2 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 495 | 1 | |
| β-strand | 496-500 | 5 | 1 |
| β-strand | 506 | 1 | 2 |
| α-helix | 507-513 | 7 | |
| α-helix | 520-539 | 20 | |
| α-helix | 549-551 | 3 | |
| β-strand | 552-556 | 5 | 2 |
| β-strand | 559-562 | 4 | 2 |
| α-helix | 586-588 | 3 | |
| α-helix | 591-596 | 6 | |
| α-helix | 601-616 | 16 | |
| α-helix | 620-621 | 2 | |
| α-helix | 628-636 | 9 | |
| α-helix | 641-644 | 4 | |
| α-helix | 649-658 | 10 | |
| α-helix | 663-665 | 3 | |
| α-helix | 667-668 | 2 | |
| α-helix | 669-685 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 416 | 1 | 3 |
| α-helix | 417-418 | 2 | |
| α-helix | 419-421 | 3 | |
| β-strand | 422-430 | 9 | 3 |
| β-strand | 435-441 | 7 | 3 |
| β-strand | 449-455 | 7 | 3 |
| α-helix | 462-475 | 14 | |
| β-strand | 483 | 1 | 4 |
| α-helix | 484-485 | 2 | |
| β-strand | 486-490 | 5 | 3 |
| α-helix | 495 | 1 | |
| β-strand | 496-500 | 5 | 3 |
| β-strand | 506 | 1 | 4 |
| α-helix | 507-513 | 7 | |
| α-helix | 520-539 | 20 | |
| α-helix | 549-551 | 3 | |
| β-strand | 552-556 | 5 | 4 |
| β-strand | 559-562 | 4 | 4 |
| α-helix | 586-588 | 3 | |
| α-helix | 591-596 | 6 | |
| α-helix | 601-616 | 16 | |
| α-helix | 620-621 | 2 | |
| α-helix | 628-636 | 9 | |
| α-helix | 641-644 | 4 | |
| α-helix | 649-658 | 10 | |
| α-helix | 663-665 | 3 | |
| α-helix | 667-668 | 2 | |
| α-helix | 669-685 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A, B | protein | 282 | Homo sapiens | Q05397 (AlphaFold model) |
>6YT6_1 Focal adhesion kinase 1 (chains A, B) GSGSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREK FLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYA YQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIK WMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNC PPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| PKE | ~{N}-methyl-~{N}-[3-[[[2-[(2-oxidanylidene-1,3-dihydroindol-5-yl)amino]pyrimidi… | C20 H21 N7 O3 S | 2 |
Water and common crystallization additives (SO4) are not listed.
Structure-kinetic relationship reveals the mechanism of selectivity of FAK inhibitors over PYK2. Berger, B.T., Amaral, M., Kokh, D.B. et al. Cell Chem Biol (2021) 28:686. DOI 10.1016/j.chembiol.2021.01.003 · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.