6Z0G: TREM2 transmembrane helix in DPC micelles

Structure of TREM2 transmembrane helix in DPC micelles. Determined by solution NMR. Released 16 Sept 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 352
Mol. weight: 5.17 kDa
Released: 16 Sept 2020

Explore 6Z0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z0G contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	3-5	3
α-helix	12-29	18
α-helix	31-38	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Triggering receptor expressed on myeloid cells 2	A	protein	49	Homo sapiens	Q9NZC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6Z0G_1 Triggering receptor expressed on myeloid cells 2 (chains A)
GSGRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTH

Primary citation

gamma-Secretase cleavage of the Alzheimer risk factor TREM2 is determined by its intrinsic structural dynamics. Steiner, A., Schlepckow, K., Brunner, B. et al. EMBO J (2020) 39:e104247-e104247. DOI 10.15252/embj.2019104247 · PubMed

Other PDB entries of the same protein (UniProt Q9NZC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
5UD8 1.8 Å, Crystal Structure of Mutant Ig-like Domain
9PWN 1.8 Å, Crystal structure of Fabs 7411 in complex with TREM2 peptide
8T51 1.9 Å, Crystal structure of Fab 3.10C2 bound to TREM2
8T59 2.0 Å, Crystal structure of Para.09 bound to TREM2
6B8O 2.2 Å, WT Ig-like V Domain with Phosphatidylserine
5UD7 2.2 Å, Crystal Structure of Wild-Type Ig-like Domain
6Y6C 2.26 Å, TREM2 extracellular domain (19-174) in complex with single-chain variable fragment…
6YMQ 3.07 Å, TREM2 extracellular domain (19-131) in complex with single-chain variable 4 (scFv-4)
5ELI 3.1 Å, Triggering receptor expressed on myeloid cells 2
6YYE 3.36 Å, TREM2 extracellular domain (19-131) in complex with single-chain variable fragment…
9PX5 3.7 Å, Crystal structure of Fab 7268 in complex with MBP-TREM2 Ig domain fusion

Browse structure collections

About this viewer

MolViewer shows 6Z0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.