Structure of TREM2 transmembrane helix K186A variant in DPC micelles. Determined by solution NMR. Released 16 Sept 2020.
Explore 6Z0H in 3D Show helices and sheets RCSB PDB PDBe
6Z0H contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| α-helix | 9-11 | 3 | |
| α-helix | 12-37 | 26 | |
| α-helix | 38-40 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Triggering receptor expressed on myeloid cells 2 | A | protein | 49 | Homo sapiens | Q9NZC2 (AlphaFold model) |
>6Z0H_1 Triggering receptor expressed on myeloid cells 2 (chains A) GSGRSLLEGEIPFPPTSILLLLACIFLIAILAASALWAAAWHGQKPGTH
gamma-Secretase cleavage of the Alzheimer risk factor TREM2 is determined by its intrinsic structural dynamics. Steiner, A., Schlepckow, K., Brunner, B. et al. EMBO J (2020) 39:e104247-e104247. DOI 10.15252/embj.2019104247 · PubMed
Other PDB entries of the same protein (UniProt Q9NZC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Z0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.