6Z5N: DnaJB1 JD-GF

DnaJB1 JD-GF. Determined by solution NMR. Released 18 Nov 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 863
Mol. weight: 12.22 kDa
Released: 18 Nov 2020

Explore 6Z5N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6Z5N contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-9	5
α-helix	17-30	14
α-helix	41-56	16
α-helix	58-66	9
α-helix	70-73	4
α-helix	99-105	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily B member 1	A	protein	110	Homo sapiens	P25685 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6Z5N_1 DnaJ homolog subfamily B member 1 (chains A)
MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRK
REIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRN

Primary citation

HSP40 proteins use class-specific regulation to drive HSP70 functional diversity. Faust, O., Abayev-Avraham, M., Wentink, A.S. et al. Nature (2020) 587:489-494. DOI 10.1038/s41586-020-2906-4 · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGX 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
3AGZ 2.51 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
7NDX 2.54 Å, Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
2QLD 2.7 Å, human Hsp40 Hdj1
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 6Z5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.