6ZEE: PP1(7-300)

Structure of PP1(7-300) bound to Phactr1 (507-580) at pH8.4. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Sept 2020.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 12
Atoms: 18,501
Mol. weight: 266.45 kDa
Ligands: 16P, MN
Released: 30 Sept 2020

Explore 6ZEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZEE contains 111 α-helices and 108 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	23	1
α-helix	26-28	3
α-helix	32-48	17
β-strand	52-55	4	13
β-strand	59-62	4	14
β-strand	64	1	15
α-helix	69-79	11
β-strand	87-89	3	14
α-helix	100-113	14
β-strand	118-120	3	14
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	13
β-strand	169-171	3	13
α-helix	183-187	5
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	16
β-strand	216-218	3	16
β-strand	225-227	3	16
α-helix	229-239	11
β-strand	243-246	4	13
β-strand	255-258	4	13
β-strand	263-266	4	13
β-strand	267	1	15
α-helix	272-274	3
α-helix	278-279	2
β-strand	280-285	6	14
β-strand	290-297	8	14

Chain B: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	23	1
α-helix	32-48	17
β-strand	52-55	4	9
β-strand	59-62	4	10
β-strand	64	1	11
α-helix	69-79	11
β-strand	87-89	3	10
α-helix	100-113	14
β-strand	118-120	3	10
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	9
β-strand	169-172	4	9
α-helix	183-187	5
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	12
β-strand	216-218	3	12
β-strand	225-227	3	12
α-helix	229-238	10
β-strand	243-246	4	9
β-strand	255-258	4	9
β-strand	263-266	4	9
β-strand	267	1	11
α-helix	272-274	3
β-strand	280-285	6	10
β-strand	290-297	8	10

Chains C, D, U, V, W and X: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	521-522	2	14
β-strand	527-530	4	14
α-helix	531-532	2
α-helix	541-544	4
α-helix	547-563	17
α-helix	569-574	6

Chain I: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
α-helix	26-28	3
α-helix	32-48	17
β-strand	52-55	4	17
β-strand	60A-62	4	18
β-strand	64	1	19
α-helix	69-79	11
β-strand	87-89	3	18
α-helix	100-113	14
β-strand	118-120	3	18
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	17
β-strand	169-171	3	17
α-helix	183-187	5
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	20
β-strand	216-218	3	20
β-strand	225-227	3	20
α-helix	229-239	11
β-strand	243-246	4	17
β-strand	255-258	4	17
β-strand	263-266	4	17
β-strand	267	1	19
α-helix	272-274	3
β-strand	280-285	6	18
β-strand	290-297	8	18

Chain K: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	23	1
α-helix	26-28	3
α-helix	32-48	17
β-strand	52-55	4	21
β-strand	60A-62	4	22
β-strand	64	1	23
α-helix	69-79	11
β-strand	87-89	3	22
α-helix	100-113	14
β-strand	118-120	3	22
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	21
β-strand	169-171	3	21
α-helix	183-187	5
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	24
β-strand	216-218	3	24
β-strand	225-227	3	24
α-helix	229-239	11
β-strand	243-246	4	21
β-strand	255-258	4	21
β-strand	263-266	4	21
β-strand	267	1	23
α-helix	272-274	3
β-strand	280-285	6	22
β-strand	290-297	8	22

Chain P: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	23	1
α-helix	32-48	17
β-strand	52-55	4	1
β-strand	60A-62	4	2
β-strand	64	1	3
α-helix	69-79	11
β-strand	87-89	3	2
α-helix	100-113	14
β-strand	118-120	3	2
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	1
β-strand	169-171	3	1
α-helix	184-187	4
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	4
β-strand	216-218	3	4
β-strand	225-227	3	4
α-helix	229-239	11
β-strand	243-246	4	1
β-strand	255-258	4	1
β-strand	263-266	4	1
β-strand	267	1	3
α-helix	272-274	3
α-helix	278-279	2
β-strand	280-285	6	2
β-strand	290-297	8	2

Chain Q: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	32-48	17
β-strand	52-55	4	5
β-strand	60A-62	4	6
β-strand	64	1	7
α-helix	69-79	11
β-strand	87-89	3	6
α-helix	100-113	14
β-strand	118-120	3	6
α-helix	121-123	3
α-helix	128-131	4
α-helix	136-143	8
α-helix	146-156	11
β-strand	162-165	4	5
β-strand	169-171	3	5
α-helix	184-187	4
α-helix	194-196	3
α-helix	200-206	7
β-strand	208-209	2	8
β-strand	216-218	3	8
β-strand	225-227	3	8
α-helix	229-239	11
β-strand	243-246	4	5
β-strand	255-258	4	5
β-strand	263-266	4	5
β-strand	267	1	7
α-helix	272-274	3
β-strand	280-285	6	6
β-strand	290-297	8	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit	A, B, I, K, P, Q	protein	299	Homo sapiens	P62136 (AlphaFold model)
Phosphatase and actin regulator	C, D, U, V, W, X	protein	78	Homo sapiens	Q9C0D0 (AlphaFold model)

Sequence of entity 1 (A, B, I, K, P, Q), FASTA

>6ZEE_1 Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (chains A, B, I, K, P, Q)
GHMGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD

Sequence of entity 2 (C, D, U, V, W, X), FASTA

>6ZEE_2 Phosphatase and actin regulator (chains C, D, U, V, W, X)
GPLGSPTVEELRERKILIRFSDYVEVADAQDYDRRADKPWTRLTAADKAAIRKELNEFKS
TEMEVHELSRHLTRFHRP

Ligands and cofactors

ID	Name	Formula	Copies
16P	3,6,9,12,15,18-hexaoxaicosane	C14 H30 O6	1
MN	Manganese (II) ion	Mn	12

Water and common crystallization additives (SO4, GOL, EDO) are not listed.

Primary citation

Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme. Fedoryshchak, R.O., Prechova, M., Butler, A. et al. Elife (2020) 9. DOI 10.7554/eLife.61509 · PubMed

Other PDB entries of the same protein (UniProt P62136 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZEG 1.09 Å, Structure of PP1-IRSp53 chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)] bound to…
6ZEH 1.3 Å, Structure of PP1-spectrin alpha II chimera [PP1(7-304) + linker (G/S)x9 + spectrin alpha…
6ZEI 1.39 Å, Structure of PP1-IRSp53 S455E chimera [PP1(7-304) + linker (G/S)x9 + IRSp53(449-465)]…
6DNO 1.45 Å, Crystal structure of Protein Phosphatase 1 (PP1) bound to the muscle glycogen-targeting…
4MOV 1.45 Å, 1.45 A Resolution Crystal Structure of Protein Phosphatase 1
6OBR 1.5 Å, PP1 Y134A in complex with Microcystin LR
3E7A 1.63 Å, Crystal Structure of Protein Phosphatase-1 Bound to the natural toxin Nodularin-R
3E7B 1.7 Å, Crystal Structure of Protein Phosphatase-1 Bound to the natural toxin inhibitor Tautomycin
8SW6 1.76 Å, Protein Phosphatase 1 in complex with PP1-specific Phosphatase targeting peptide…
6ZEJ 1.78 Å, Structure of PP1-Phactr1 chimera [PP1(7-304) + linker (SGSGS) + Phactr1(526-580)]
7T0Y 1.8 Å, The Ribosomal RNA Processing 1B Protein Phosphatase-1 Holoenzyme
6OBS 1.8 Å, PP1 Y134K

Browse structure collections

About this viewer

MolViewer shows 6ZEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.