Structure of PP1(7-300) bound to Phactr1 (516-580) at pH 5.25. Determined by X-ray diffraction at 1.94 Å resolution. Released 30 Sept 2020.
Explore 6ZEF in 3D Show helices and sheets RCSB PDB PDBe
6ZEF contains 32 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-17 | 9 | |
| α-helix | 32-48 | 17 | |
| β-strand | 52-55 | 4 | 1 |
| β-strand | 60A-62 | 4 | 2 |
| β-strand | 64 | 1 | 3 |
| α-helix | 69-79 | 11 | |
| β-strand | 87-89 | 3 | 2 |
| α-helix | 100-113 | 14 | |
| β-strand | 118-120 | 3 | 2 |
| α-helix | 121-123 | 3 | |
| α-helix | 128-131 | 4 | |
| α-helix | 136-143 | 8 | |
| α-helix | 146-156 | 11 | |
| β-strand | 162-165 | 4 | 1 |
| β-strand | 169-171 | 3 | 1 |
| α-helix | 184-187 | 4 | |
| α-helix | 200-206 | 7 | |
| β-strand | 208-209 | 2 | 4 |
| β-strand | 216-218 | 3 | 4 |
| β-strand | 225-227 | 3 | 4 |
| α-helix | 229-238 | 10 | |
| β-strand | 243-246 | 4 | 1 |
| β-strand | 255-258 | 4 | 1 |
| β-strand | 263-266 | 4 | 1 |
| β-strand | 267 | 1 | 3 |
| α-helix | 272-274 | 3 | |
| β-strand | 280-285 | 6 | 2 |
| β-strand | 290-297 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-18 | 10 | |
| α-helix | 19-21 | 3 | |
| α-helix | 32-48 | 17 | |
| β-strand | 52-55 | 4 | 5 |
| β-strand | 59A-62 | 4 | 6 |
| β-strand | 64 | 1 | 7 |
| α-helix | 69-79 | 11 | |
| β-strand | 87-89 | 3 | 6 |
| α-helix | 100-113 | 14 | |
| β-strand | 118-120 | 3 | 6 |
| α-helix | 121-123 | 3 | |
| α-helix | 128-131 | 4 | |
| α-helix | 136-143 | 8 | |
| α-helix | 146-156 | 11 | |
| β-strand | 162-165 | 4 | 5 |
| β-strand | 169-171 | 3 | 5 |
| α-helix | 184-187 | 4 | |
| α-helix | 200-206 | 7 | |
| β-strand | 208-209 | 2 | 8 |
| β-strand | 216-218 | 3 | 8 |
| β-strand | 225-227 | 3 | 8 |
| α-helix | 229-239 | 11 | |
| β-strand | 243-246 | 4 | 5 |
| β-strand | 255-258 | 4 | 5 |
| β-strand | 263-266 | 4 | 5 |
| β-strand | 267 | 1 | 7 |
| α-helix | 272-274 | 3 | |
| β-strand | 280-285 | 6 | 6 |
| β-strand | 290-297 | 8 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 521-522 | 2 | 2 |
| β-strand | 527-530 | 4 | 2 |
| α-helix | 531-532 | 2 | |
| α-helix | 541-544 | 4 | |
| α-helix | 547-563 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 521-522 | 2 | 6 |
| β-strand | 527-530 | 4 | 6 |
| α-helix | 531-532 | 2 | |
| α-helix | 541-544 | 4 | |
| α-helix | 547-559 | 13 | |
| α-helix | 560-564 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein phosphatase PP1-alpha catalytic subunit | A, B | protein | 299 | Homo sapiens | P62136 (AlphaFold model) |
| Phosphatase and actin regulator | C, D | protein | 70 | Homo sapiens | Q9C0D0 (AlphaFold model) |
>6ZEF_1 Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (chains A, B) GHMGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKI CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
>6ZEF_2 Phosphatase and actin regulator (chains C, D) GPLGSRKILIRFSDYVEVADAQDYDRRADKPWTRLTAADKAAIRKELNEFKSTEMEVHEL SRHLTRFHRP
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 4 |
Water and common crystallization additives (EDO, CL) are not listed.
Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme. Fedoryshchak, R.O., Prechova, M., Butler, A. et al. Elife (2020) 9. DOI 10.7554/eLife.61509 · PubMed
Other PDB entries of the same protein (UniProt P62136 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.