Structure of the human RBAP48 in complex with a macrocyclic peptide cyclized via a xylene linker attached to two cysteines. Determined by X-ray diffraction at 2.6 Å resolution. Released 28 Oct 2020.
Explore 6ZRC in 3D Show helices and sheets RCSB PDB PDBe
6ZRC contains 16 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-31 | 21 | |
| β-strand | 32-39 | 8 | 1 |
| β-strand | 48-54 | 7 | 2 |
| α-helix | 55-56 | 2 | |
| β-strand | 61-69 | 9 | 2 |
| β-strand | 78-87 | 10 | 2 |
| β-strand | 114-122 | 9 | 2 |
| β-strand | 129-133 | 5 | 3 |
| β-strand | 136-143 | 8 | 3 |
| β-strand | 149-153 | 5 | 3 |
| α-helix | 154-156 | 3 | |
| β-strand | 183-185 | 3 | 4 |
| β-strand | 192-196 | 5 | 4 |
| β-strand | 202-206 | 5 | 4 |
| β-strand | 221-223 | 3 | 4 |
| β-strand | 230-235 | 6 | 5 |
| β-strand | 242-247 | 6 | 5 |
| β-strand | 251-256 | 6 | 5 |
| β-strand | 267-270 | 4 | 5 |
| β-strand | 276-281 | 6 | 6 |
| β-strand | 288-293 | 6 | 6 |
| β-strand | 297-302 | 6 | 6 |
| β-strand | 309-314 | 6 | 6 |
| β-strand | 320-325 | 6 | 7 |
| β-strand | 332-337 | 6 | 7 |
| β-strand | 342-346 | 5 | 7 |
| α-helix | 347-349 | 3 | |
| α-helix | 356-359 | 4 | |
| β-strand | 366-369 | 4 | 7 |
| β-strand | 377-382 | 6 | 1 |
| β-strand | 390-394 | 5 | 1 |
| β-strand | 398-404 | 7 | 1 |
| α-helix | 406-409 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-31 | 21 | |
| β-strand | 32-39 | 8 | 8 |
| β-strand | 48-54 | 7 | 9 |
| α-helix | 55-56 | 2 | |
| β-strand | 61-69 | 9 | 9 |
| β-strand | 78-87 | 10 | 9 |
| β-strand | 115-122 | 8 | 9 |
| β-strand | 129-133 | 5 | 10 |
| β-strand | 136-143 | 8 | 10 |
| β-strand | 149-153 | 5 | 10 |
| α-helix | 154-156 | 3 | |
| β-strand | 183-185 | 3 | 11 |
| β-strand | 192-196 | 5 | 11 |
| β-strand | 202-206 | 5 | 11 |
| β-strand | 221-223 | 3 | 11 |
| β-strand | 230-235 | 6 | 12 |
| β-strand | 242-247 | 6 | 12 |
| β-strand | 251-256 | 6 | 12 |
| β-strand | 267-270 | 4 | 12 |
| β-strand | 276-281 | 6 | 13 |
| β-strand | 288-293 | 6 | 13 |
| β-strand | 297-302 | 6 | 13 |
| β-strand | 309-314 | 6 | 13 |
| β-strand | 320-325 | 6 | 14 |
| β-strand | 332-337 | 6 | 14 |
| β-strand | 342-346 | 5 | 14 |
| α-helix | 347-349 | 3 | |
| α-helix | 356-359 | 4 | |
| β-strand | 366-369 | 4 | 14 |
| β-strand | 377-382 | 6 | 8 |
| β-strand | 390-394 | 5 | 8 |
| β-strand | 398-404 | 7 | 8 |
| α-helix | 406-409 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-6 | 4 | |
| α-helix | 13-14 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-binding protein RBBP4 | A, B | protein | 427 | Homo sapiens | Q09028 (AlphaFold model) |
| macrocyclic peptide based on residues 659-672 of the metastasis-associated protein MTA1 | P, Q | protein | 16 | Homo sapiens | Q13330 (AlphaFold model) |
>6ZRC_1 Histone-binding protein RBBP4 (chains A, B) GPMADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEG KDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIE IKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQK EGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLL HESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTV ALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPED AEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSV DPEGQGS
>6ZRC_2 macrocyclic peptide based on residues 659-672 of the metastasis-associated protein MTA1 (chains P, Q) XCTKRAARRPYKPCAX
| ID | Name | Formula | Copies |
|---|---|---|---|
| PXY | Para-xylene | C8 H10 | 2 |
Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48. Hart, P.'., Hommen, P., Noisier, A. et al. Angew Chem Int Ed Engl (2021) 60:1813-1820. DOI 10.1002/anie.202009749 · PubMed
Other PDB entries of the same protein (UniProt Q09028 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.