7A6A: Ferritin heavy chain

1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope. Determined by electron microscopy at 1.15 Å resolution. Released 2 Sept 2020.

Method: Electron microscopy
Resolution: 1.15 Å
Organism: Homo sapiens
Chains: 24
Atoms: 41,613
Mol. weight: 511.23 kDa
Released: 2 Sept 2020

Explore 7A6A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7A6A contains 192 α-helices and 24 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains 1, 2, 4, 6, a, A, B, e, E, F, G, H, I, K, M, O, P, Q, r, S, U, W, X and Y: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	14-41	28
α-helix	49-76	28
β-strand	85	1	2
α-helix	86-88	3
α-helix	96-123	28
α-helix	127-133	7
α-helix	134-138	5
α-helix	139-158	20
α-helix	164-173	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain	1, 2, 4, 6, A, B, E, F, G, H, I, K, M, O, P, Q, S, U, W, X, Y, a, e, r	protein	183	Homo sapiens	P02794 (AlphaFold model)

Sequence of entity 1 (1, 2, 4, 6, A, B, E, F, G, H, I, K, M, O, P, Q, S, U, W, X, Y, a, e, r), FASTA

>7A6A_1 Ferritin heavy chain (chains 1, 2, 4, 6, A, B, E, F, G, H, I, K, M, O, P, Q, S, U, W, X, Y, a, e, r)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
NES

Primary citation

Atomic-resolution protein structure determination by cryo-EM. Yip, K.M., Fischer, N., Paknia, E. et al. Nature (2020) 587:157-161. DOI 10.1038/s41586-020-2833-4 · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…
4OYN 1.43 Å, Fifteen minutes iron loaded human H ferritin

Browse structure collections

About this viewer

MolViewer shows 7A6A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.