7ADS: Orf virus Apoptosis inhibitor ORFV125

Name: PDB 7ADS: Orf virus Apoptosis inhibitor ORFV125
Published: 2021-10-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Orf virus Apoptosis inhibitor ORFV125. Determined by X-ray diffraction at 2.22 Å resolution. Released 6 Oct 2021.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Orf virus
Chains: 1
Atoms: 1,109
Mol. weight: 16.88 kDa
Ligands: MG
Released: 6 Oct 2021

Explore 7ADS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ADS contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	31-44	14
α-helix	50-57	8
α-helix	67-69	3
α-helix	70-79	10
α-helix	85-101	17
α-helix	105-107	3
α-helix	108-120	13
α-helix	126-141	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis inhibitor	A	protein	148	Orf virus	A0A0R8HV90

Sequence of entity 1 (A), FASTA

>7ADS_1 Apoptosis inhibitor (chains A)
GPLGSMANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLV
YVLLDRLPPTADEDLGAWLQAVARVHGT

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Water and common crystallization additives (CL, NA, EDO) are not listed.

Primary citation

Crystal structures of ORFV125 provide insight into orf virus-mediated inhibition of apoptosis. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Biochem J (2020) 477:4527-4541. DOI 10.1042/BCJ20200776 · PubMed

Other PDB entries of the same protein (UniProt A0A0R8HV90), best resolution first:

7P0U 1.99 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide
7ADT 2.21 Å, Orf virus Apoptosis inhibitor ORFV125
7P0S 2.5 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide

Browse structure collections

About this viewer

MolViewer shows 7ADS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.