7ADT: Orf virus Apoptosis inhibitor ORFV125

Name: PDB 7ADT: Orf virus Apoptosis inhibitor ORFV125
Published: 2021-10-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Orf virus Apoptosis inhibitor ORFV125. Determined by X-ray diffraction at 2.21 Å resolution. Released 6 Oct 2021.

Method: X-ray diffraction
Resolution: 2.21 Å
Organisms: Orf virus, Homo sapiens
Chains: 4
Atoms: 2,510
Mol. weight: 40.24 kDa
Ligands: MG
Released: 6 Oct 2021

Explore 7ADT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ADT contains 14 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	31-57	27
α-helix	69-78	10
α-helix	85-101	17
α-helix	107-120	14
α-helix	126-140	15

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	9-28	20
α-helix	31-57	27
α-helix	69-79	11
α-helix	85-101	17
α-helix	106-121	16
α-helix	126-140	15

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	53-73	21

Chain U: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	54-72	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis inhibitor	A, B	protein	148	Orf virus	A0A0R8HV90
Apoptosis regulator BAX	C, U	protein	28	Homo sapiens	Q07812 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7ADT_1 Apoptosis inhibitor (chains A, B)
GPLGSMANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSPLLQEL
SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGRLWTRGRQLVDFMRLV
YVLLDRLPPTADEDLGAWLQAVARVHGT

Sequence of entity 2 (C, U), FASTA

>7ADT_2 Apoptosis regulator BAX (chains C, U)
VPQDASTKKLSECLKRIGDELDSNMELQ

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	41

Water and common crystallization additives (GOL, EDO) are not listed.

Primary citation

Crystal structures of ORFV125 provide insight into orf virus-mediated inhibition of apoptosis. Suraweera, C.D., Hinds, M.G., Kvansakul, M. Biochem J (2020) 477:4527-4541. DOI 10.1042/BCJ20200776 · PubMed

Other PDB entries of the same protein (UniProt A0A0R8HV90), best resolution first:

7P0U 1.99 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide
7ADS 2.22 Å, Orf virus Apoptosis inhibitor ORFV125
7P0S 2.5 Å, ORF virus encoded Bcl-2 homolog ORFV125 in complex with Puma BH3 peptide

Browse structure collections

About this viewer

MolViewer shows 7ADT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.