7ALN: Actin-1

Cryo-EM structure of the divergent actomyosin complex from Plasmodium falciparum Myosin A in the Rigor state. Determined by electron microscopy at 3.77 Å resolution. Released 28 Apr 2021.

Method: Electron microscopy
Resolution: 3.77 Å
Organism: Plasmodium falciparum (isolate 3D7)
Chains: 6
Atoms: 20,789
Mol. weight: 306.47 kDa
Ligands: ADP, MG, 9UE
Released: 28 Apr 2021

Explore 7ALN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ALN contains 140 α-helices and 125 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and E: 21 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
β-strand	18-22	5	1
β-strand	30-32	3	1
β-strand	36-39	4	2
β-strand	43	1	3
β-strand	54-55	2	2
α-helix	57-61	5
α-helix	63-65	3
β-strand	66-69	4	2
β-strand	72-73	2	4
β-strand	76-77	2	4
α-helix	80-88	9
α-helix	89-95	7
β-strand	104-108	5	1
α-helix	114-122	9
α-helix	123-127	5
β-strand	132	1	5
β-strand	133-137	5	1
α-helix	138-145	8
β-strand	150-154	5	6
β-strand	163-167	5	6
β-strand	170-171	2	6
α-helix	183-197	15
α-helix	204-217	14
α-helix	224-230	7
β-strand	239-242	4	7
β-strand	248-251	4	7
α-helix	253-255	3
α-helix	260-262	3
α-helix	265-267	3
α-helix	275-284	10
α-helix	291-295	5
β-strand	298-300	3	6
α-helix	303-305	3
α-helix	310-321	12
β-strand	330-331	2	6
α-helix	339-348	10
α-helix	353-355	3
β-strand	359	1	5
α-helix	360-366	7
α-helix	367-372	6

Chains B and D: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	8
β-strand	18-22	5	8
β-strand	30-32	3	8
β-strand	36-39	4	9
β-strand	54-55	2	9
α-helix	57-61	5
α-helix	63-65	3
β-strand	66-69	4	9
β-strand	72-73	2	10
β-strand	76-77	2	10
α-helix	80-88	9
α-helix	89-95	7
β-strand	104-108	5	8
α-helix	114-122	9
α-helix	123-127	5
β-strand	132	1	11
β-strand	133-137	5	8
α-helix	138-145	8
β-strand	150-154	5	3
β-strand	163-167	5	3
β-strand	170-171	2	3
α-helix	183-197	15
α-helix	204-217	14
α-helix	224-230	7
β-strand	239-242	4	12
β-strand	248-251	4	12
α-helix	253-255	3
α-helix	260-262	3
α-helix	265-267	3
α-helix	275-284	10
α-helix	291-295	5
β-strand	298-300	3	3
α-helix	303-305	3
α-helix	310-321	12
β-strand	330-331	2	3
α-helix	339-348	10
α-helix	353-355	3
β-strand	359	1	11
α-helix	360-366	7
α-helix	367-372	6

Chain F: 35 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	20-22	3
β-strand	24	1	31
β-strand	31	1	31
β-strand	35-38	4	32
α-helix	42-46	5
β-strand	53-57	5	32
α-helix	58	1
β-strand	66-72	7	32
β-strand	80-82	3	32
β-strand	87-88	2	32
α-helix	102-104	3
α-helix	110-122	13
β-strand	127-128	2	33
β-strand	133-137	5	33
α-helix	148-156	9
α-helix	164	1
α-helix	167-180	14
β-strand	185-191	7	33
α-helix	197-209	13
α-helix	220-226	7
α-helix	228-235	8
β-strand	236-239	4	34
β-strand	242-246	5	34
β-strand	249-256	8	33
α-helix	257	1
β-strand	262-270	9	33
β-strand	287	1	34
α-helix	289-296	8
α-helix	299-305	7
α-helix	331-340	10
α-helix	346-362	17
β-strand	367-369	3	35
β-strand	379-381	3	35
α-helix	386-395	10
α-helix	400-408	9
β-strand	409-413	5	36
β-strand	418-422	5	36
α-helix	425-455	31
β-strand	465-470	6	33
α-helix	481-511	31
α-helix	516-518	3
α-helix	525-532	8
α-helix	538-547	10
α-helix	554-563	10
β-strand	570-572	3	37
β-strand	580-585	6	37
β-strand	588-593	6	37
α-helix	597-601	5
α-helix	607-614	8
α-helix	619-624	6
α-helix	641-657	17
β-strand	660-667	8	33
α-helix	680-689	10
α-helix	692-699	8
β-strand	705-708	4	38
α-helix	709-715	7
α-helix	721-724	4
α-helix	731-741	11
β-strand	749-751	3	38
β-strand	755-758	4	38
α-helix	760-766	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-1	A, B, C, D, E	protein	376	Plasmodium falciparum (isolate 3D7)	Q8I4X0 (AlphaFold model)
Myosin-A	F	protein	818	Plasmodium falciparum (isolate 3D7)	Q8IDR3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>7ALN_1 Actin-1 (chains A, B, C, D, E)
MGEEDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDEAQ
TKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRERM
TQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLD
LAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIEKS
YELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNIVL
SGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITK
EEYDESGPSIVHRKCF

Sequence of entity 2 (F), FASTA

>7ALN_2 Myosin-A (chains F)
MAVTNEEIKTASKIVRRVSNVEAFDKSGSVFKGYQIWTDISPTIENDPNIMFVKCVVQQG
SKKEKLTVVQIDPPGTGTPYDIDPTHAWNCNSQVDPMSFGDIGLLNHTNIPCVLDFLKHR
YLKNQIYTTAVPLIVAINPYKDLGNTTNEWIRRYRDTADHTKLPPHVFTCAREALSNLHG
VNKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLRIQTAIMAANPVLEAFGNAKTI
RNNNSSRFGRFMQLVISHEGGIRYGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGANST
MKSKFGLKGVTEYKLLNPNSTEVSGVDDVKDFEEVIESLKNMELSESDIEVIFSIVAGIL
TLGNVRLIEKQEAGLSDAAAIMDEDMGVFNKACELMYLDPELIKREILIKVTVAGGDKIE
GRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPEGGFKTFMGMLDIFGFEVFKNNS
LEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAELKYTSNKEVINVLCEKGKSVLS
YLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASNKNFIIQHTIGPIQYCAESFLLK
NKDVLRGDLVEVIKDSPNPIVQQLFEGQVIEKGKIAKGSLIGSQFLNQLTSLMNLINSTE
PHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFEEFLYQYKFVD
IAAAEDSSVENQNKCVNILKLSGLSESMYKIGKSMVFLKQEGAKILTKIQREKLVEWENC
VSVIEAAILKHKYKQKVNKNIPSLLRVQAHIRKKMVAQ

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	5
MG	Magnesium ion	Mg	5
9UE	Jasplakinolide	C36 H45 Br N4 O6	3

Primary citation

The actomyosin interface contains an evolutionary conserved core and an ancillary interface involved in specificity. Robert-Paganin, J., Xu, X.P., Swift, M.F. et al. Nat Commun (2021) 12:1892-1892. DOI 10.1038/s41467-021-22093-4 · PubMed

Other PDB entries of the same protein (UniProt Q8I4X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6I4E 1.22 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-ADP state
6I4D 1.24 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-K-ATP/ADP state
4CBU 1.3 Å, Crystal structure of Plasmodium falciparum actin I
5MVV 1.4 Å, Crystal structure of Plasmodium falciparum actin I- gelsolin segment 1 -CdATP complex
6I4H 1.4 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Ca-ATP state
6I4F 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (A272W mutant) in the Mg-K-ATP/ADP…
6I4J 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-ADP state
6I4K 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Ca-ATP state
6I4L 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Mg-K-ATP/ADP…
6I4I 1.9 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-K-ADP-AlFn…
6I4G 2.0 Å, Crystal Structure of Plasmodium falciparum actin I (H74Q) in the Mg-K-ATP state
6TU4 2.6 Å, Structure of Plasmodium Actin1 filament

Browse structure collections

About this viewer

MolViewer shows 7ALN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.