7B96: NHL domain of human TRIM2

NHL domain of human TRIM2. Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Jan 2022.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,633
Mol. weight: 60.24 kDa
Released: 12 Jan 2022

Explore 7B96 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7B96 contains 4 α-helices and 64 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 32 β-strands

Element	Residues	Length	Sheet
β-strand	472-476	5	1
β-strand	478-479	2	2
β-strand	485-486	2	2
β-strand	489-494	6	3
β-strand	499-504	6	3
β-strand	509-514	6	3
β-strand	519-523	5	3
β-strand	526	1	4
β-strand	533	1	4
β-strand	536-541	6	5
β-strand	547-551	5	5
β-strand	556-560	5	5
β-strand	566-570	5	5
β-strand	578-583	6	6
β-strand	589-593	5	6
β-strand	598-602	5	6
β-strand	608-612	5	6
β-strand	614-615	2	7
β-strand	621-622	2	7
β-strand	625-630	6	8
β-strand	636-640	5	8
β-strand	645-649	5	8
β-strand	655-659	5	8
β-strand	661-662	2	9
β-strand	668-669	2	9
β-strand	672-677	6	10
β-strand	683-687	5	10
β-strand	692-696	5	10
β-strand	702-705	4	10
β-strand	719-721	3	1
β-strand	727-731	5	1
α-helix	732-734	3
β-strand	736-740	5	1

Chain B: 3 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	472-476	5	11
β-strand	478-479	2	12
β-strand	485-486	2	12
β-strand	489-494	6	13
β-strand	499-504	6	13
β-strand	509-514	6	13
β-strand	519-523	5	13
β-strand	526	1	14
β-strand	533	1	14
β-strand	536-541	6	15
β-strand	547-551	5	15
β-strand	556-560	5	15
β-strand	566-570	5	15
β-strand	578-583	6	16
α-helix	588	1
β-strand	589-593	5	16
β-strand	598-602	5	16
β-strand	608-612	5	16
β-strand	615	1	17
β-strand	622	1	17
β-strand	625-630	6	18
β-strand	636-640	5	18
α-helix	641-643	3
β-strand	645-649	5	18
β-strand	655-659	5	18
β-strand	661-662	2	19
β-strand	668-669	2	19
β-strand	672-677	6	20
β-strand	683-687	5	20
β-strand	692-696	5	20
β-strand	702-705	4	20
β-strand	719-721	3	11
β-strand	727-731	5	11
α-helix	732-734	3
β-strand	736-740	5	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Tripartite motif-containing protein 2	A, B	protein	280	Homo sapiens	Q9C040 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7B96_1 Isoform 2 of Tripartite motif-containing protein 2 (chains A, B)
GPMGEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFG
IRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVD
RNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNH
SVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLS
YINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ

Primary citation

NHL domain of human TRIM2. Williams, F.P., Hennig, J., Foot, J. To be published.

Other PDB entries of the same protein (UniProt Q9C040 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QRV 1.45 Å, Crystal structure of NHL domain of TRIM2 (full C-terminal)
7B2R 1.6 Å, Crystal structure of NHL domain of TRIM2
8A38 2.2 Å, RING domain of human TRIM2
8AMS 2.4 Å, Complex of human TRIM2 RING domain, UBCH5C, and Ubiquitin
7ZJ3 2.53 Å, Structure of TRIM2 RING domain in complex with UBE2D1~Ub conjugate

Browse structure collections

About this viewer

MolViewer shows 7B96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.