7BF8: Beta-lactoglobulin

Mutant I56F of recombinant bovine beta-lactoglobulin in complex with tetracaine. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Jan 2021.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,762
Mol. weight: 37.09 kDa
Ligands: TE4
Released: 13 Jan 2021

Explore 7BF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BF8 contains 11 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
β-strand	17-18	2	1
β-strand	20-26	7	1
α-helix	29-31	3
β-strand	41-48	8	1
β-strand	54-62	9	1
β-strand	65-75	11	1
β-strand	81-84	4	1
β-strand	91-97	7	1
β-strand	102-108	7	1
β-strand	117-123	7	1
α-helix	130-140	11
β-strand	147-150	4	1
α-helix	153-156	4
α-helix	159-161	3

Chain BBB: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
α-helix	12-15	4
β-strand	17-18	2	2
β-strand	20-26	7	1
α-helix	29-31	3
β-strand	42-48	7	2
β-strand	54-62	9	2
β-strand	65-73	9	2
β-strand	74-75	2	1
β-strand	81-83	3	1
β-strand	91-97	7	1
β-strand	102-108	7	1
β-strand	117-123	7	1
α-helix	130-140	11
β-strand	147-150	4	1
α-helix	153-156	4
α-helix	159-161	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactoglobulin	AAA, BBB	protein	162	Bos taurus	P02754 (AlphaFold model)

Sequence of entity 1 (AAA, BBB), FASTA

>7BF8_1 Beta-lactoglobulin (chains AAA, BBB)
ASVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEFLLQK
WENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQ
CLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Ligands and cofactors

ID	Name	Formula	Copies
TE4	Tetracaine	C15 H24 N2 O2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Interactions of new lactoglobulin variants with tetracaine: crystallographic studies of ligand binding to lactoglobulin mutants possessing single substitution in the binding pocket. Loch, J., Bonarek, P., Siuda, M. et al. Acta Biochim Pol (2021) 68:23-28. DOI 10.18388/abp.2020_5593 · PubMed

Other PDB entries of the same protein (UniProt P02754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q19 1.55 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#3)
4GNY 1.64 Å, Bovine beta-lactoglobulin complex with dodecyl sulfate
7Q2P 1.69 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#2)
5NUK 1.7 Å, Engineered beta-lactoglobulin: variant I56F-L39A-M107F in complex with chlorpromazine…
7Q2N 1.7 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F) in complex with desipramine (FAF-DSM)
7KOT 1.74 Å, Energetic and structural effects of the Tanford transition on the ligand recognition of…
1BEB 1.8 Å, Bovine beta-lactoglobulin, lattice X
7BF9 1.8 Å, Mutant M107L of recombinant bovine beta-lactoglobulin in complex with tetracaine
7Q17 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W), unliganded form
7Q2O 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#1)
7Q18 1.8 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F), unliganded form
4KII 1.85 Å, Beta-lactoglobulin in complex with Cp*Rh(III)Cl N,N-di(pyridin-2-yl)dodecanamide

Browse structure collections

About this viewer

MolViewer shows 7BF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.