7BP2: Histone H2A.6

Structural mechanism directing nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1). Determined by X-ray diffraction at 1.58 Å resolution. Released 11 Nov 2020.

Method: X-ray diffraction
Resolution: 1.58 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 3,188
Mol. weight: 43.46 kDa
Released: 11 Nov 2020

Explore 7BP2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BP2 contains 18 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
α-helix	27-36	10
β-strand	42-43	2	1
α-helix	46-72	27
β-strand	77-78	2	2
α-helix	80-88	9
α-helix	91-97	7

Chains B and D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	38-48	11
β-strand	53-54	2	2
α-helix	56-83	28
β-strand	88-89	2	1
α-helix	91-101	11
α-helix	104-122	19

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	17-20	4
α-helix	27-36	10
β-strand	42-43	2	3
α-helix	46-72	27
β-strand	77-78	2	4
α-helix	80-88	9
α-helix	91-97	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2A.6	A, C	protein	93	Arabidopsis thaliana	Q9LD28 (AlphaFold model)
Histone H2B.1	B, D	protein	98	Arabidopsis thaliana	Q9LQQ4 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7BP2_1 Histone H2A.6 (chains A, C)
KKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAAR
DNKKTRIVPRHIQLAVRNDEELSKLLGDVTIAN

Sequence of entity 2 (B, D), FASTA

>7BP2_2 Histone H2B.1 (chains B, D)
KKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKK
PTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

Primary citation

NAP1-Related Protein 1 (NRP1) has multiple interaction modes for chaperoning histones H2A-H2B. Luo, Q., Wang, B., Wu, Z. et al. Proc Natl Acad Sci U S A (2020) 117:30391-30399. DOI 10.1073/pnas.2011089117 · PubMed

Other PDB entries of the same protein (UniProt Q9LD28 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BP6 1.58 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7BP5 1.9 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7BP4 2.1 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
7C7X 3.0 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
9K42 3.14 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with 147bp Widom 601 DNA (C2…
9K40 3.15 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with Arabidopsis native 147bp…
8KCB 3.17 Å, Complex of DDM1-nucleosome(H2A) complex with DDM1 bound to SHL2
8WHB 3.17 Å, Structure of nucleosome core particle of Arabidopsis thaliana
9K44 3.22 Å, Cryo-EM structure of Arabidopsis thaliana H2A-H3.3-nucleosome with Arabidopsis native…
8WH9 3.31 Å, Structure of DDM1-nucleosome complex in ADP-BeFx state
8WH5 3.58 Å, Structure of DDM1-nucleosome complex in the apo state
8WH8 3.6 Å, Structure of DDM1-nucleosome complex in ADP state

Browse structure collections

About this viewer

MolViewer shows 7BP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.