Complex structure of SAV1 and Dendrin. Determined by X-ray diffraction at 1.55 Å resolution. Released 23 Sept 2020.
Explore 7BQG in 3D Show helices and sheets RCSB PDB PDBe
7BQG contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 200-203 | 4 | |
| β-strand | 206-210 | 5 | 1 |
| β-strand | 216-220 | 5 | 1 |
| β-strand | 225-227 | 3 | 1 |
| α-helix | 237-238 | 2 | |
| β-strand | 241-246 | 6 | 2 |
| β-strand | 250-255 | 6 | 2 |
| β-strand | 260-262 | 3 | 2 |
| α-helix | 272-275 | 4 | |
| α-helix | 277-281 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein salvador homolog 1,Dendrin | A | protein | 90 | Mus musculus | Q80TS7 (AlphaFold model), Q8VEB2 (AlphaFold model) |
>7BQG_1 Protein salvador homolog 1,Dendrin (chains A) GPGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYY VDHTNKRAQYRHPCAPSVPPPYVAPPSYEG
A WW Tandem-Mediated Dimerization Mode of SAV1 Essential for Hippo Signaling. Lin, Z., Xie, R., Guan, K. et al. Cell Rep (2020) 32:108118-108118. DOI 10.1016/j.celrep.2020.108118 · PubMed
Other PDB entries of the same protein (UniProt Q80TS7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7BQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.