7BQG: Complex structure of SAV1 and Dendrin

Complex structure of SAV1 and Dendrin. Determined by X-ray diffraction at 1.55 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Mus musculus
Chains: 1
Atoms: 811
Mol. weight: 10.44 kDa
Released: 23 Sept 2020

Explore 7BQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BQG contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	200-203	4
β-strand	206-210	5	1
β-strand	216-220	5	1
β-strand	225-227	3	1
α-helix	237-238	2
β-strand	241-246	6	2
β-strand	250-255	6	2
β-strand	260-262	3	2
α-helix	272-275	4
α-helix	277-281	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein salvador homolog 1,Dendrin	A	protein	90	Mus musculus	Q80TS7 (AlphaFold model), Q8VEB2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BQG_1 Protein salvador homolog 1,Dendrin (chains A)
GPGSEDLPLPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYY
VDHTNKRAQYRHPCAPSVPPPYVAPPSYEG

Primary citation

A WW Tandem-Mediated Dimerization Mode of SAV1 Essential for Hippo Signaling. Lin, Z., Xie, R., Guan, K. et al. Cell Rep (2020) 32:108118-108118. DOI 10.1016/j.celrep.2020.108118 · PubMed

Other PDB entries of the same protein (UniProt Q80TS7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJZ 1.65 Å, Crystal Structure of MAGI2 and Dendrin complex
6JK1 2.0 Å, Crystal Structure of YAP1 and Dendrin complex 2
6KKG 2.15 Å, Crystal structure of MAGI2-Dendrin complex
6J69 2.75 Å, Structure of KIBRA and Dendrin Complex
6JK0 3.1 Å, Crystal Structure of YAP1 and Dendrin complex

Browse structure collections

About this viewer

MolViewer shows 7BQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.