Crystal structure of FYCO1 RUN domain. Determined by X-ray diffraction at 1.3 Å resolution. Released 5 Aug 2020.
Explore 7BQI in 3D Show helices and sheets RCSB PDB PDBe
7BQI contains 12 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-31 | 26 | |
| β-strand | 35 | 1 | 1 |
| α-helix | 40-54 | 15 | |
| β-strand | 57 | 1 | 2 |
| α-helix | 58-59 | 2 | |
| β-strand | 61 | 1 | 3 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 3 |
| α-helix | 68 | 1 | |
| α-helix | 70-78 | 9 | |
| α-helix | 86-92 | 7 | |
| α-helix | 100-113 | 14 | |
| α-helix | 117-126 | 10 | |
| α-helix | 128-134 | 7 | |
| β-strand | 135 | 1 | 2 |
| α-helix | 140-142 | 3 | |
| α-helix | 144-158 | 15 | |
| β-strand | 162 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FYVE and coiled-coil domain-containing protein 1 | A | protein | 183 | Homo sapiens | Q9BQS8 (AlphaFold model) |
>7BQI_1 FYVE and coiled-coil domain-containing protein 1 (chains A) GPLGSMASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQF DQKEKATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQ RLADTLQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAW PTF
Crystal structure of the FYCO1 RUN domain suggests possible interfaces with small GTPases. Sakurai, S., Shimizu, T., Ohto, U. Acta Crystallogr F Struct Biol Commun (2020) 76:326-333. DOI 10.1107/S2053230X20009012 · PubMed
Other PDB entries of the same protein (UniProt Q9BQS8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7BQI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.