5CX3: FYCO1 LIR
Crystal structure of FYCO1 LIR in complex with LC3A. Determined by X-ray diffraction at 2.3 Å resolution. Released 3 Aug 2016.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 4,705
- Mol. weight
- 70.86 kDa
- Released
- 3 Aug 2016
Explore 5CX3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5CX3 contains 36 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-26 | 14 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 38 | 1 | |
| α-helix | 45-47 | 3 | |
| β-strand | 49-55 | 7 | 1 |
| β-strand | 59 | 1 | 2 |
| α-helix | 60-71 | 12 | |
| β-strand | 79-83 | 5 | 1 |
| β-strand | 87 | 1 | 1 |
| β-strand | 94 | 1 | 2 |
| α-helix | 95-102 | 8 | |
| α-helix | 108 | 1 | |
| β-strand | 109-115 | 7 | 1 |
| α-helix | 116-119 | 4 | |
Chains B and D: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-26 | 14 | |
| β-strand | 30-37 | 8 | 3 |
| α-helix | 38 | 1 | |
| α-helix | 45-47 | 3 | |
| β-strand | 51-55 | 5 | 3 |
| β-strand | 59 | 1 | 4 |
| α-helix | 60-70 | 11 | |
| β-strand | 79-83 | 5 | 3 |
| β-strand | 87 | 1 | 3 |
| β-strand | 94 | 1 | 4 |
| α-helix | 95-102 | 8 | |
| α-helix | 108 | 1 | |
| β-strand | 109-115 | 7 | 3 |
| α-helix | 116-119 | 4 | |
Chain C: 8 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-26 | 14 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 38 | 1 | |
| α-helix | 45-47 | 3 | |
| β-strand | 51-55 | 5 | 1 |
| β-strand | 59 | 1 | 5 |
| α-helix | 60-71 | 12 | |
| β-strand | 79-83 | 5 | 1 |
| β-strand | 87 | 1 | 1 |
| β-strand | 94 | 1 | 5 |
| α-helix | 95-102 | 8 | |
| α-helix | 108 | 1 | |
| β-strand | 109-115 | 7 | 1 |
| α-helix | 116-119 | 4 | |
Chain E: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1276-1282 | 7 | 1 |
| α-helix | 1285-1289 | 5 | |
Chain F: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1281-1282 | 2 | 3 |
| α-helix | 1285-1290 | 6 | |
Chains G and H: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 1281-1282 | 2 | 1 |
| α-helix | 1285-1288 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Microtubule-associated proteins 1A/1B light chain 3A | A, B, C, D | protein | 121 | Homo sapiens | Q9H492 (AlphaFold model) |
| FYVE and coiled-coil domain-containing protein 1 | E, F, G, H | protein | 31 | Homo sapiens | Q9BQS8 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>5CX3_1 Microtubule-associated proteins 1A/1B light chain 3A (chains A, B, C, D)
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
F
Sequence of entity 2 (E, F, G, H), FASTA
>5CX3_2 FYVE and coiled-coil domain-containing protein 1 (chains E, F, G, H)
RPPDDAVFDIITDEELCQIQESGSSLVPRGS
Primary citation
Structural basis of FYCO1 and MAP1LC3A interaction reveals a novel binding mode for Atg8-family proteins. Cheng, X., Wang, Y., Gong, Y. et al. Autophagy (2016) 12:1330-1339. DOI 10.1080/15548627.2016.1185590 · PubMed
Other PDB entries of the same protein (UniProt Q9H492 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7RA0 1.36 Å, LC3A in complex with Fragment 2-10
- 6TBE 1.67 Å, LC3A in complex with (3R,4S,5R,6R)-5-hydroxy-6-((4-hydroxy-3-(4-hydroxy-3-isopentylbenzam…
- 7R9Z 1.72 Å, LC3A in complex with Fragment 2-3
- 7R9W 1.75 Å, LC3A in complex with Fragment 1-1
- 3WAN 1.77 Å, Crystal structure of Atg13 LIR-fused human LC3A_2-121
- 4ZDV 1.8 Å, Crystal structure of LC3 in complex with FAM134B LIR
- 8T36 1.85 Å, Crystal structure of K49 acetylated LC3A in complex with the LIR of TP53INP2/DOR
- 8T35 1.9 Å, Crystal structure of K51 acetylated LC3A in complex with the LIR of TP53INP2/DOR
- 3WAL 2.0 Å, Crystal structure of human LC3A_2-121
- 8T2L 2.24 Å, Crystal structure of LC3A in complex with the LIR of NSs4
- 8T4T 2.36 Å, Crystal structure of LC3A in complex with the LIR of TP53INP2/DOR
- 5DPR 2.5 Å, Crystal structure of PLEKHM1 LIR-fused human LC3A_2-121
Browse structure collections
About this viewer
MolViewer shows 5CX3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.