7BXH: MavC-Lpg2149 complex

MavC-Lpg2149 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 May 2020.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Chains: 2
Atoms: 3,908
Mol. weight: 56.36 kDa
Released: 20 May 2020

Explore 7BXH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BXH contains 29 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	12-36	25
α-helix	44-53	10
α-helix	70-77	8
α-helix	79-82	4
α-helix	92-109	18

Chain B: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-24	15
α-helix	25-29	5
α-helix	33-42	10
α-helix	45-47	3
α-helix	54-63	10
α-helix	70-71	2
α-helix	74-96	23
β-strand	100-101	2	1
α-helix	102-103	2
α-helix	107-110	4
β-strand	118-126	9	1
β-strand	132-135	4	2
α-helix	138-140	3
α-helix	147	1
β-strand	150-153	4	2
β-strand	158-161	4	2
β-strand	167-169	3	2
α-helix	174-183	10
α-helix	187-190	4
β-strand	191-193	3	2
α-helix	201-203	3
α-helix	205-220	16
α-helix	221-223	3
β-strand	228-237	10	1
β-strand	249-251	3	1
β-strand	254	1	3
β-strand	258	1	3
α-helix	260-265	6
α-helix	268-273	6
α-helix	277-289	13
α-helix	293-304	12
α-helix	306	1
α-helix	316-318	3
β-strand	324-332	9	1
α-helix	335-352	18
α-helix	358-380	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lpg2149	A	protein	105	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZTL2 (AlphaFold model)
MavC	B	protein	386	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZTL4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BXH_1 Lpg2149 (chains A)
SGTFFKDYQKKNVMRLLQDSLEKIINEWLKTDDESHTKLKSLQELSEMDINATSFAEHSP
LPDFVTRLWLDPHKALDAMDKNISKNEIRKLIKETAREIELVFTH

Sequence of entity 2 (B), FASTA

>7BXH_2 MavC (chains B)
SMTTSKLEKTGLHVHEKIKHMVKNYGTMITGIPAEILGQNEAEISVGYVKKMGNMKENIA
EVVRKSEMTQPTNSCGKASNEVCDLLLGTEGASEFEKSSYQVLSGDGSNLKGSLPNKNLL
VRVEMDRFNAPQKYQKIKREEFNPETAEKNKIYLLEDQLVYLDIFGKVIDLGQTSDTCHR
LFNAITTPFYQNYILYDEYIDPEESAEEAAMFEMGEIVKAKMKNIDCWTATHSFTIFVPE
SDSEDTRTLYPYQAYWTSHTLQQWFSGDKDEKLSRLGIDGYIEKLALLGTTTDSKIRSSI
YGELFSPPGKEHVFCTGMNEKFSPLRVKFKVTEVNPEIALQNLEEVQEFIDTNYPGENAK
DQCELYKIKAQEAMTKQLEMRLLIEP

Primary citation

Insights into catalysis and regulation of non-canonical ubiquitination and deubiquitination by bacterial deamidase effectors. Wang, Y., Zhan, Q., Wang, X. et al. Nat Commun (2020) 11:2751-2751. DOI 10.1038/s41467-020-16587-w · PubMed

Other PDB entries of the same protein (UniProt Q5ZTL2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K3B 1.97 Å, Crystal structure of Lpg2147-Lpg2149 complex
6LW4 2.7 Å, Structure of Lpg2148/Lpg2149 complex
7BXF 2.7 Å, MvcA-Lpg2149 complex

Browse structure collections

About this viewer

MolViewer shows 7BXH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.