Crystal structure of the FERM domain of FRMPD4. Determined by X-ray diffraction at 2.49 Å resolution. Released 16 Dec 2020.
Explore 7BYJ in 3D Show helices and sheets RCSB PDB PDBe
7BYJ contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 200-202 | 3 | 1 |
| β-strand | 205-209 | 5 | 1 |
| β-strand | 215-219 | 5 | 1 |
| β-strand | 225 | 1 | 2 |
| α-helix | 226-237 | 12 | |
| α-helix | 242-244 | 3 | |
| β-strand | 245-252 | 8 | 1 |
| α-helix | 253 | 1 | |
| β-strand | 258-263 | 6 | 1 |
| β-strand | 268 | 1 | 2 |
| α-helix | 269-272 | 4 | |
| α-helix | 278-280 | 3 | |
| β-strand | 282-287 | 6 | 1 |
| α-helix | 294-300 | 7 | |
| α-helix | 302-317 | 16 | |
| α-helix | 327-343 | 17 | |
| α-helix | 353-359 | 7 | |
| α-helix | 362-365 | 4 | |
| α-helix | 368-373 | 6 | |
| α-helix | 376-393 | 18 | |
| α-helix | 398-401 | 4 | |
| α-helix | 402-414 | 13 | |
| β-strand | 422-430 | 9 | 3 |
| β-strand | 433-442 | 10 | 3 |
| β-strand | 446-452 | 7 | 3 |
| β-strand | 457-462 | 6 | 3 |
| α-helix | 464-466 | 3 | |
| β-strand | 467-472 | 6 | 3 |
| β-strand | 479-486 | 8 | 3 |
| α-helix | 490-491 | 2 | |
| β-strand | 492-497 | 6 | 3 |
| α-helix | 498-515 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FERM and PDZ domain-containing protein 4 | A | protein | 339 | Homo sapiens | Q14CM0 (AlphaFold model) |
>7BYJ_1 FERM and PDZ domain-containing protein 4 (chains A) GPGSTVKDNSLLFMPNVLKVYLENGQTKSFRFDCSTSIKDVILTLQEKLSIKGIEHFSLM LEQRTEGAGTKLLLLHEQETLTQVTQRPSSHKMRCLFRISFVPKDPIDLLRRDPVAFEYL YVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTKQTQKISLKYIEKEWGLETFLPS AVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKATL VQAEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFSEEESLVRVELHVLD VKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMAN
Structure of the FERM domain of a neural scaffold protein FRMPD4 implicated in X-linked intellectual disability. Wang, M., Lin, L., Shi, Y. et al. Biochem J (2020) 477:4623-4634. DOI 10.1042/BCJ20200857 · PubMed
Other PDB entries of the same protein (UniProt Q14CM0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7BYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.