Crystal structure of the TPR domain of LGN in complex with Frmpd4/Preso1 at 2.0 Angstrom resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Sept 2015.
Explore 4WNE in 3D Show helices and sheets RCSB PDB PDBe
4WNE contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-29 | 17 | |
| α-helix | 33-46 | 14 | |
| α-helix | 51-67 | 17 | |
| α-helix | 71-87 | 17 | |
| α-helix | 91-107 | 17 | |
| α-helix | 111-127 | 17 | |
| α-helix | 131-151 | 21 | |
| α-helix | 165-188 | 24 | |
| α-helix | 191-207 | 17 | |
| α-helix | 211-228 | 18 | |
| α-helix | 231-247 | 17 | |
| α-helix | 251-268 | 18 | |
| α-helix | 271-288 | 18 | |
| α-helix | 291-307 | 17 | |
| α-helix | 311-328 | 18 | |
| α-helix | 331-346 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 994-1001 | 8 | |
| α-helix | 1007-1010 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| G-protein-signaling modulator 2 | A | protein | 406 | Homo sapiens | P81274 (AlphaFold model) |
| Peptide from FERM and PDZ domain-containing protein 4 | B | protein | 25 | Homo sapiens | Q14CM0 (AlphaFold model) |
>4WNE_1 G-protein-signaling modulator 2 (chains A) GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYL HDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISREL NDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTAL GDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFL GEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQEL NDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVL GLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEK
>4WNE_2 Peptide from FERM and PDZ domain-containing protein 4 (chains B) KQLLHSDHMEMEPETMETKSVTDYF
Structural basis for the recognition of the scaffold protein Frmpd4/Preso1 by the TPR domain of the adaptor protein LGN. Takayanagi, H., Yuzawa, S., Sumimoto, H. Acta Crystallogr F Struct Biol Commun (2015) 71:175-183. DOI 10.1107/S2053230X14028143 · PubMed
Other PDB entries of the same protein (UniProt P81274 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.